Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7WNA8

Protein Details
Accession A0A2B7WNA8   
Localization Confidence Low
Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-91VLECKCSHGKNKPKTTKLNLDRCLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, plas 6, golg 4, extr 2, pero 2, E.R. 2, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011058  Cyanovirin-N  
IPR036673  Cyanovirin-N_sf  
Pfam View protein in Pfam  
PF08881  CVNH  
Amino Acid Sequences MNYIPAFSPSTGTPIFSSLSQKKSLREKDTTMKLTLFTTLFVLACLLLSVSADYTKSCKDCKIGKYKVLECKCSHGKNKPKTTKLNLDRCLMNSKGTMKPKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.25
5 0.25
6 0.29
7 0.34
8 0.36
9 0.4
10 0.49
11 0.56
12 0.54
13 0.54
14 0.56
15 0.58
16 0.64
17 0.61
18 0.53
19 0.45
20 0.39
21 0.35
22 0.31
23 0.23
24 0.15
25 0.12
26 0.1
27 0.1
28 0.09
29 0.08
30 0.06
31 0.05
32 0.05
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.06
42 0.08
43 0.09
44 0.1
45 0.12
46 0.17
47 0.23
48 0.31
49 0.4
50 0.43
51 0.47
52 0.53
53 0.58
54 0.62
55 0.6
56 0.58
57 0.49
58 0.52
59 0.55
60 0.55
61 0.56
62 0.56
63 0.62
64 0.67
65 0.77
66 0.79
67 0.79
68 0.81
69 0.82
70 0.83
71 0.83
72 0.83
73 0.77
74 0.71
75 0.66
76 0.59
77 0.57
78 0.47
79 0.4
80 0.33
81 0.34
82 0.38
83 0.45