Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XR12

Protein Details
Accession A0A2B7XR12    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
222-269RRPLHPKPSNMARRKNKKVMAKKRRKPIAQFKRNPQPKPKPKAPEAAIBasic
NLS Segment(s)
PositionSequence
222-264RRPLHPKPSNMARRKNKKVMAKKRRKPIAQFKRNPQPKPKPKA
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, plas 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPDYMYEGYINEQTYARPHTPIPEGVRFREALWEHFEQDGQEDFEGFTDEGLAVEEDEFEEYEYEEDEYEEDEEVILSMTAQDYEVFRNMRRNEHVFIRVTSDARGTITWKKLDNDYQHLSLNPNQPTTDAKLACEVCGCVKEEEEENKESRSLQVMKLIMTMILTLMLEHLTEDVMSFMQGNGLEELEVNLILYEVYDFVFSGAGLSIFMMVVSSQTYSHRRPLHPKPSNMARRKNKKVMAKKRRKPIAQFKRNPQPKPKPKAPEAAIEIVCLGSESRRGLVEMLSEAPTSVLAMLTEWIEDLIRLIPSTAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.26
3 0.25
4 0.24
5 0.25
6 0.28
7 0.32
8 0.38
9 0.41
10 0.44
11 0.46
12 0.47
13 0.49
14 0.45
15 0.4
16 0.42
17 0.37
18 0.31
19 0.33
20 0.32
21 0.31
22 0.31
23 0.31
24 0.22
25 0.23
26 0.22
27 0.17
28 0.15
29 0.13
30 0.12
31 0.12
32 0.14
33 0.12
34 0.09
35 0.08
36 0.08
37 0.07
38 0.08
39 0.08
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.08
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.06
71 0.08
72 0.12
73 0.13
74 0.15
75 0.23
76 0.25
77 0.3
78 0.35
79 0.37
80 0.37
81 0.41
82 0.44
83 0.38
84 0.37
85 0.36
86 0.32
87 0.29
88 0.26
89 0.21
90 0.17
91 0.15
92 0.15
93 0.14
94 0.18
95 0.21
96 0.23
97 0.25
98 0.26
99 0.29
100 0.35
101 0.36
102 0.37
103 0.37
104 0.36
105 0.34
106 0.33
107 0.32
108 0.31
109 0.33
110 0.28
111 0.25
112 0.23
113 0.23
114 0.25
115 0.26
116 0.27
117 0.2
118 0.19
119 0.23
120 0.23
121 0.22
122 0.2
123 0.17
124 0.11
125 0.13
126 0.14
127 0.09
128 0.09
129 0.1
130 0.12
131 0.16
132 0.18
133 0.19
134 0.18
135 0.19
136 0.19
137 0.18
138 0.16
139 0.17
140 0.15
141 0.13
142 0.17
143 0.17
144 0.17
145 0.17
146 0.16
147 0.12
148 0.1
149 0.09
150 0.04
151 0.04
152 0.04
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.03
167 0.05
168 0.05
169 0.06
170 0.05
171 0.06
172 0.05
173 0.05
174 0.06
175 0.05
176 0.05
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.04
202 0.04
203 0.05
204 0.09
205 0.14
206 0.17
207 0.25
208 0.31
209 0.35
210 0.44
211 0.54
212 0.61
213 0.65
214 0.67
215 0.67
216 0.71
217 0.76
218 0.76
219 0.76
220 0.76
221 0.78
222 0.84
223 0.86
224 0.82
225 0.82
226 0.85
227 0.86
228 0.86
229 0.87
230 0.86
231 0.88
232 0.9
233 0.87
234 0.86
235 0.86
236 0.86
237 0.86
238 0.87
239 0.86
240 0.87
241 0.88
242 0.85
243 0.85
244 0.85
245 0.84
246 0.85
247 0.84
248 0.83
249 0.8
250 0.82
251 0.74
252 0.72
253 0.66
254 0.64
255 0.55
256 0.45
257 0.4
258 0.3
259 0.26
260 0.18
261 0.13
262 0.06
263 0.09
264 0.11
265 0.12
266 0.13
267 0.14
268 0.14
269 0.15
270 0.16
271 0.14
272 0.15
273 0.16
274 0.15
275 0.14
276 0.14
277 0.12
278 0.11
279 0.09
280 0.07
281 0.05
282 0.06
283 0.07
284 0.07
285 0.07
286 0.07
287 0.07
288 0.07
289 0.06
290 0.07
291 0.08
292 0.09
293 0.09