Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BTA8

Protein Details
Accession G8BTA8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
14-39NTVRSKLLTCTRKRKQERKDFNLRVLHydrophilic
89-109QPKPRHPDQIHQKQSQRRAPQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 5
Family & Domain DBs
KEGG tpf:TPHA_0E00400  -  
Amino Acid Sequences MPQASYYTDLSLINTVRSKLLTCTRKRKQERKDFNLRVLIGHASLLDRLLDEYEERVNASHNGNDEVEGYGDNYILSTPKQPHSTILYQPKPRHPDQIHQKQSQRRAPQAVSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.19
5 0.19
6 0.2
7 0.29
8 0.35
9 0.42
10 0.52
11 0.59
12 0.69
13 0.79
14 0.83
15 0.85
16 0.87
17 0.89
18 0.87
19 0.9
20 0.83
21 0.78
22 0.75
23 0.64
24 0.53
25 0.44
26 0.36
27 0.24
28 0.2
29 0.14
30 0.08
31 0.08
32 0.07
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.09
46 0.09
47 0.1
48 0.1
49 0.12
50 0.12
51 0.12
52 0.12
53 0.1
54 0.09
55 0.08
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.04
62 0.05
63 0.06
64 0.1
65 0.13
66 0.17
67 0.21
68 0.21
69 0.25
70 0.3
71 0.34
72 0.38
73 0.45
74 0.49
75 0.54
76 0.59
77 0.65
78 0.65
79 0.63
80 0.66
81 0.59
82 0.62
83 0.65
84 0.71
85 0.71
86 0.73
87 0.78
88 0.76
89 0.82
90 0.81
91 0.79
92 0.75
93 0.74