Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BV38

Protein Details
Accession G8BV38    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
59-83IKERDVYKIKKKKKLIEQKEFKINKBasic
148-180NFMKSNNNYDKHKRRRSKKKQFKEEISAKKQLNHydrophilic
NLS Segment(s)
PositionSequence
47-47K
49-111IDRNLKKNIEIKERDVYKIKKKKKLIEQKEFKINKVKELKLEQNAKLSILKKHKSEGTLTKKE
158-170KHKRRRSKKKQFK
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031404  Rrt14  
Gene Ontology GO:0005730  C:nucleolus  
KEGG tpf:TPHA_0F01350  -  
Pfam View protein in Pfam  
PF17075  RRT14  
Amino Acid Sequences MTSFVNSTEQATKSVNDLLSSLLPGATKLKINSNNIRSESTKGSKAKLIDRNLKKNIEIKERDVYKIKKKKKLIEQKEFKINKVKELKLEQNAKLSILKKHKSEGTLTKKEKKYLRAVSDQNINKAKSWDFDEDEKEELQNVQNEIMNFMKSNNNYDKHKRRRSKKKQFKEEISAKKQLNVDHRYPGLTPGLAPVGLSDEEDSSEEEKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.19
4 0.19
5 0.18
6 0.17
7 0.17
8 0.15
9 0.11
10 0.1
11 0.1
12 0.13
13 0.12
14 0.15
15 0.16
16 0.24
17 0.3
18 0.38
19 0.46
20 0.49
21 0.54
22 0.54
23 0.56
24 0.5
25 0.47
26 0.47
27 0.42
28 0.44
29 0.39
30 0.39
31 0.39
32 0.41
33 0.45
34 0.46
35 0.5
36 0.53
37 0.59
38 0.66
39 0.68
40 0.67
41 0.61
42 0.59
43 0.58
44 0.57
45 0.52
46 0.47
47 0.49
48 0.49
49 0.5
50 0.51
51 0.51
52 0.52
53 0.58
54 0.62
55 0.63
56 0.69
57 0.74
58 0.77
59 0.82
60 0.82
61 0.83
62 0.84
63 0.81
64 0.84
65 0.76
66 0.68
67 0.66
68 0.56
69 0.53
70 0.51
71 0.47
72 0.42
73 0.46
74 0.49
75 0.47
76 0.53
77 0.45
78 0.42
79 0.41
80 0.37
81 0.35
82 0.3
83 0.3
84 0.32
85 0.34
86 0.3
87 0.33
88 0.35
89 0.32
90 0.35
91 0.38
92 0.39
93 0.46
94 0.49
95 0.55
96 0.55
97 0.6
98 0.6
99 0.56
100 0.56
101 0.54
102 0.54
103 0.53
104 0.53
105 0.5
106 0.55
107 0.5
108 0.47
109 0.44
110 0.39
111 0.33
112 0.32
113 0.3
114 0.23
115 0.26
116 0.23
117 0.22
118 0.24
119 0.26
120 0.26
121 0.26
122 0.25
123 0.2
124 0.17
125 0.15
126 0.15
127 0.15
128 0.13
129 0.13
130 0.15
131 0.15
132 0.17
133 0.16
134 0.15
135 0.12
136 0.13
137 0.17
138 0.16
139 0.22
140 0.27
141 0.31
142 0.37
143 0.47
144 0.56
145 0.62
146 0.72
147 0.76
148 0.8
149 0.87
150 0.92
151 0.94
152 0.94
153 0.95
154 0.95
155 0.95
156 0.93
157 0.92
158 0.9
159 0.89
160 0.85
161 0.82
162 0.71
163 0.66
164 0.6
165 0.55
166 0.55
167 0.51
168 0.47
169 0.45
170 0.46
171 0.43
172 0.4
173 0.38
174 0.31
175 0.25
176 0.21
177 0.18
178 0.18
179 0.16
180 0.15
181 0.12
182 0.13
183 0.12
184 0.13
185 0.12
186 0.1
187 0.12
188 0.13
189 0.15
190 0.13