Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3I3A5

Protein Details
Accession A0A2H3I3A5    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
43-63AVSRLQRIRKIKKRVKERGAEBasic
NLS Segment(s)
PositionSequence
49-60RIRKIKKRVKER
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MASTLNRLVDQQEKLEAQEEEAGDKVLVLHKELMELQSSLAEAVSRLQRIRKIKKRVKERGAELFERGMQELNKEDNILPALQSHEERP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.24
4 0.19
5 0.21
6 0.19
7 0.16
8 0.15
9 0.15
10 0.11
11 0.11
12 0.1
13 0.1
14 0.1
15 0.1
16 0.11
17 0.11
18 0.12
19 0.13
20 0.13
21 0.1
22 0.1
23 0.09
24 0.08
25 0.08
26 0.06
27 0.06
28 0.05
29 0.04
30 0.06
31 0.07
32 0.08
33 0.09
34 0.11
35 0.17
36 0.26
37 0.37
38 0.44
39 0.54
40 0.6
41 0.68
42 0.77
43 0.82
44 0.82
45 0.8
46 0.76
47 0.75
48 0.74
49 0.67
50 0.57
51 0.49
52 0.41
53 0.34
54 0.29
55 0.21
56 0.15
57 0.15
58 0.17
59 0.18
60 0.17
61 0.18
62 0.18
63 0.18
64 0.19
65 0.18
66 0.15
67 0.13
68 0.16
69 0.17