Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8C296

Protein Details
Accession G8C296    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-45DGNTPKNVMKKVRKPRSKKVNKLSESQHydrophilic
NLS Segment(s)
PositionSequence
28-38KKVRKPRSKKV
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
KEGG tpf:TPHA_0P01160  -  
PROSITE View protein in PROSITE  
PS50888  BHLH  
Amino Acid Sequences MSDLKLGITELDNLSEKNDGNTPKNVMKKVRKPRSKKVNKLSESQIKMNHVTSEQKRRMLVRSIYDDLVEAVPDLSAEESRSELLIYLKTVNYMNWLYKRNEVLRTQLVNKYKERGMYNKYSIPQNLIWEQKRNKNPNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.15
5 0.2
6 0.22
7 0.24
8 0.28
9 0.32
10 0.36
11 0.42
12 0.45
13 0.5
14 0.56
15 0.62
16 0.7
17 0.76
18 0.79
19 0.82
20 0.87
21 0.89
22 0.9
23 0.9
24 0.89
25 0.89
26 0.82
27 0.79
28 0.77
29 0.74
30 0.68
31 0.61
32 0.53
33 0.46
34 0.44
35 0.4
36 0.32
37 0.25
38 0.28
39 0.3
40 0.37
41 0.38
42 0.39
43 0.4
44 0.41
45 0.42
46 0.41
47 0.39
48 0.33
49 0.35
50 0.34
51 0.33
52 0.31
53 0.27
54 0.21
55 0.17
56 0.12
57 0.07
58 0.04
59 0.04
60 0.04
61 0.04
62 0.03
63 0.03
64 0.04
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.09
75 0.08
76 0.1
77 0.1
78 0.09
79 0.12
80 0.13
81 0.17
82 0.2
83 0.24
84 0.25
85 0.29
86 0.34
87 0.35
88 0.39
89 0.36
90 0.38
91 0.4
92 0.42
93 0.42
94 0.44
95 0.46
96 0.45
97 0.46
98 0.45
99 0.4
100 0.42
101 0.42
102 0.43
103 0.44
104 0.47
105 0.51
106 0.52
107 0.53
108 0.53
109 0.5
110 0.47
111 0.43
112 0.4
113 0.41
114 0.44
115 0.45
116 0.49
117 0.55
118 0.6
119 0.68