Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BWW2

Protein Details
Accession G8BWW2    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
169-194LSKSTTTKVHKRQRRGRSCDNCRMNKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG tpf:TPHA_0H00560  -  
Amino Acid Sequences MSSKNFVISNNNNSLPILLVPYLHHGEGKVNYHLNPICKIDETFKNMGRLKALNNSNNKENMNLITFPNRLPTPPHSPERFCGENMNCDNITLSRCLANLDSKASTQIRLPEVQFPKSSFCEKTYAYNSTPRNYQWKTARKEIFNRNSDNNVSRLVESVQDYQLRSNRLSKSTTTKVHKRQRRGRSCDNCRMNKTRCDARFEVLLQNKYVMRSISKKLHYILKKRDIIKYSKHGMILEHIKIPEDLLKDNDHGVKLIKSLDKIILFHPCSSCHRTYTYNKKNVDKTHGRECIYSTGYIKSDMHIYNVMIHNISKELPLSGGNGLSKKLYDLTISDYKKYFVNGET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.31
3 0.24
4 0.19
5 0.13
6 0.12
7 0.13
8 0.18
9 0.2
10 0.19
11 0.19
12 0.17
13 0.21
14 0.25
15 0.29
16 0.28
17 0.29
18 0.29
19 0.36
20 0.38
21 0.37
22 0.35
23 0.34
24 0.31
25 0.31
26 0.32
27 0.31
28 0.35
29 0.39
30 0.41
31 0.42
32 0.48
33 0.49
34 0.49
35 0.46
36 0.42
37 0.38
38 0.41
39 0.45
40 0.44
41 0.5
42 0.53
43 0.54
44 0.56
45 0.53
46 0.45
47 0.4
48 0.35
49 0.3
50 0.27
51 0.24
52 0.24
53 0.25
54 0.24
55 0.27
56 0.25
57 0.22
58 0.26
59 0.3
60 0.34
61 0.39
62 0.47
63 0.47
64 0.5
65 0.52
66 0.54
67 0.51
68 0.42
69 0.44
70 0.38
71 0.41
72 0.4
73 0.41
74 0.34
75 0.31
76 0.31
77 0.24
78 0.24
79 0.16
80 0.15
81 0.12
82 0.12
83 0.13
84 0.14
85 0.16
86 0.16
87 0.18
88 0.18
89 0.17
90 0.22
91 0.21
92 0.21
93 0.19
94 0.22
95 0.22
96 0.24
97 0.25
98 0.29
99 0.31
100 0.34
101 0.33
102 0.3
103 0.31
104 0.31
105 0.34
106 0.27
107 0.25
108 0.27
109 0.26
110 0.31
111 0.32
112 0.33
113 0.31
114 0.37
115 0.37
116 0.35
117 0.37
118 0.33
119 0.37
120 0.34
121 0.39
122 0.42
123 0.48
124 0.51
125 0.58
126 0.62
127 0.57
128 0.64
129 0.67
130 0.67
131 0.63
132 0.62
133 0.55
134 0.53
135 0.51
136 0.44
137 0.35
138 0.28
139 0.24
140 0.2
141 0.18
142 0.15
143 0.14
144 0.14
145 0.15
146 0.15
147 0.16
148 0.16
149 0.17
150 0.2
151 0.2
152 0.2
153 0.24
154 0.24
155 0.25
156 0.26
157 0.26
158 0.3
159 0.34
160 0.4
161 0.41
162 0.47
163 0.55
164 0.62
165 0.67
166 0.7
167 0.74
168 0.78
169 0.82
170 0.82
171 0.82
172 0.84
173 0.85
174 0.85
175 0.84
176 0.79
177 0.75
178 0.74
179 0.68
180 0.63
181 0.6
182 0.58
183 0.52
184 0.53
185 0.49
186 0.42
187 0.41
188 0.37
189 0.39
190 0.36
191 0.34
192 0.27
193 0.28
194 0.26
195 0.24
196 0.23
197 0.16
198 0.14
199 0.18
200 0.23
201 0.29
202 0.31
203 0.33
204 0.34
205 0.42
206 0.46
207 0.51
208 0.55
209 0.56
210 0.6
211 0.61
212 0.65
213 0.61
214 0.59
215 0.57
216 0.55
217 0.51
218 0.47
219 0.45
220 0.4
221 0.35
222 0.36
223 0.35
224 0.29
225 0.27
226 0.24
227 0.23
228 0.22
229 0.22
230 0.2
231 0.16
232 0.15
233 0.15
234 0.16
235 0.17
236 0.19
237 0.21
238 0.17
239 0.17
240 0.17
241 0.15
242 0.15
243 0.18
244 0.18
245 0.17
246 0.18
247 0.22
248 0.22
249 0.22
250 0.23
251 0.28
252 0.27
253 0.29
254 0.29
255 0.28
256 0.33
257 0.38
258 0.38
259 0.32
260 0.34
261 0.38
262 0.46
263 0.54
264 0.59
265 0.61
266 0.64
267 0.69
268 0.74
269 0.73
270 0.73
271 0.71
272 0.67
273 0.69
274 0.7
275 0.64
276 0.58
277 0.54
278 0.51
279 0.43
280 0.4
281 0.31
282 0.28
283 0.27
284 0.29
285 0.26
286 0.21
287 0.25
288 0.23
289 0.24
290 0.22
291 0.22
292 0.25
293 0.28
294 0.28
295 0.22
296 0.22
297 0.2
298 0.2
299 0.2
300 0.14
301 0.12
302 0.11
303 0.12
304 0.12
305 0.13
306 0.13
307 0.15
308 0.17
309 0.18
310 0.18
311 0.18
312 0.18
313 0.17
314 0.18
315 0.16
316 0.15
317 0.16
318 0.22
319 0.3
320 0.33
321 0.35
322 0.34
323 0.34
324 0.34
325 0.35