Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3GGE6

Protein Details
Accession A0A2H3GGE6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
309-328TKAFESRRLKKMKVKLLRKKBasic
NLS Segment(s)
PositionSequence
315-328RRLKKMKVKLLRKK
Subcellular Location(s) plas 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046536  DUF6601  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20246  DUF6601  
Amino Acid Sequences MASPPPPFTVRILQKDFLSDGLESKDEFNSLLPASNRFNDDIVVPTSDPNFLERELSVSRLNDVQEWLWACGRPMPPRPLHHQRLISREIIISELSELHMIWWRNRIFLKPMPAYLLDPDFWVSNISDTAHLDVTEGNIDASARGFLFSYAALIAYRSDFRIAKEHGLLPEEVTWEGWKALTAQVLENHRYDRVNPRYWYGELRLSRLNKVYALRKGYLLRGYSRVASHTVYGDLIRDNFSVLAGILGYVVIALTAMQVGLGVDRLVENQAFQDVSYGLTVFTLIVPLIGALFIFLVVFVMIVSNWRVTKAFESRRLKKMKVKLLRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.47
4 0.38
5 0.32
6 0.23
7 0.19
8 0.19
9 0.19
10 0.17
11 0.18
12 0.17
13 0.15
14 0.15
15 0.14
16 0.14
17 0.13
18 0.18
19 0.17
20 0.2
21 0.24
22 0.26
23 0.28
24 0.26
25 0.26
26 0.22
27 0.22
28 0.21
29 0.19
30 0.19
31 0.17
32 0.17
33 0.17
34 0.18
35 0.17
36 0.16
37 0.15
38 0.13
39 0.15
40 0.13
41 0.17
42 0.16
43 0.19
44 0.2
45 0.19
46 0.2
47 0.21
48 0.21
49 0.18
50 0.19
51 0.16
52 0.18
53 0.19
54 0.19
55 0.18
56 0.18
57 0.17
58 0.21
59 0.25
60 0.28
61 0.33
62 0.39
63 0.44
64 0.48
65 0.57
66 0.61
67 0.63
68 0.65
69 0.66
70 0.63
71 0.64
72 0.62
73 0.54
74 0.45
75 0.39
76 0.32
77 0.25
78 0.19
79 0.13
80 0.1
81 0.09
82 0.08
83 0.07
84 0.07
85 0.06
86 0.11
87 0.12
88 0.13
89 0.2
90 0.19
91 0.23
92 0.24
93 0.26
94 0.27
95 0.3
96 0.37
97 0.32
98 0.32
99 0.31
100 0.31
101 0.29
102 0.25
103 0.23
104 0.15
105 0.13
106 0.13
107 0.11
108 0.1
109 0.1
110 0.08
111 0.07
112 0.08
113 0.08
114 0.08
115 0.09
116 0.1
117 0.09
118 0.09
119 0.08
120 0.08
121 0.07
122 0.07
123 0.07
124 0.05
125 0.05
126 0.05
127 0.04
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.05
136 0.05
137 0.04
138 0.05
139 0.04
140 0.04
141 0.05
142 0.05
143 0.06
144 0.06
145 0.08
146 0.09
147 0.1
148 0.15
149 0.16
150 0.17
151 0.19
152 0.2
153 0.18
154 0.19
155 0.18
156 0.13
157 0.13
158 0.12
159 0.1
160 0.08
161 0.08
162 0.07
163 0.07
164 0.06
165 0.05
166 0.05
167 0.06
168 0.08
169 0.08
170 0.09
171 0.13
172 0.16
173 0.18
174 0.18
175 0.18
176 0.18
177 0.18
178 0.19
179 0.25
180 0.29
181 0.34
182 0.34
183 0.37
184 0.39
185 0.39
186 0.4
187 0.33
188 0.33
189 0.27
190 0.3
191 0.33
192 0.31
193 0.32
194 0.32
195 0.3
196 0.25
197 0.28
198 0.32
199 0.32
200 0.34
201 0.33
202 0.33
203 0.34
204 0.35
205 0.35
206 0.31
207 0.27
208 0.26
209 0.27
210 0.26
211 0.25
212 0.23
213 0.2
214 0.19
215 0.18
216 0.15
217 0.14
218 0.13
219 0.12
220 0.12
221 0.11
222 0.11
223 0.11
224 0.1
225 0.1
226 0.1
227 0.09
228 0.09
229 0.07
230 0.07
231 0.05
232 0.04
233 0.04
234 0.03
235 0.03
236 0.03
237 0.02
238 0.02
239 0.02
240 0.02
241 0.02
242 0.02
243 0.02
244 0.02
245 0.03
246 0.03
247 0.03
248 0.04
249 0.03
250 0.04
251 0.04
252 0.05
253 0.07
254 0.07
255 0.07
256 0.07
257 0.09
258 0.09
259 0.09
260 0.1
261 0.08
262 0.09
263 0.09
264 0.09
265 0.07
266 0.07
267 0.07
268 0.06
269 0.06
270 0.06
271 0.05
272 0.05
273 0.05
274 0.05
275 0.04
276 0.04
277 0.04
278 0.03
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.04
288 0.04
289 0.06
290 0.07
291 0.1
292 0.11
293 0.13
294 0.14
295 0.16
296 0.23
297 0.32
298 0.4
299 0.47
300 0.57
301 0.63
302 0.72
303 0.78
304 0.77
305 0.77
306 0.78
307 0.78
308 0.79