Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3G5W5

Protein Details
Accession A0A2H3G5W5   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-91VDRLHRQKISRNWPRKKELAQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
Amino Acid Sequences MAVYNSSLESSEKGLEAYDLRDAEAFDSVEAMCKSDTVSLVVYAVAVFSHYDLIRSAIEAEKTSMLSGHFVDRLHRQKISRNWPRKKELAQLSASRLAFPQLTLLWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.12
5 0.14
6 0.13
7 0.13
8 0.14
9 0.14
10 0.13
11 0.14
12 0.12
13 0.08
14 0.09
15 0.08
16 0.11
17 0.11
18 0.11
19 0.09
20 0.09
21 0.1
22 0.1
23 0.11
24 0.08
25 0.09
26 0.08
27 0.08
28 0.08
29 0.07
30 0.06
31 0.05
32 0.04
33 0.03
34 0.03
35 0.03
36 0.05
37 0.05
38 0.06
39 0.06
40 0.08
41 0.07
42 0.08
43 0.08
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.07
53 0.08
54 0.08
55 0.09
56 0.1
57 0.1
58 0.13
59 0.21
60 0.27
61 0.29
62 0.32
63 0.32
64 0.39
65 0.48
66 0.57
67 0.59
68 0.64
69 0.71
70 0.76
71 0.81
72 0.81
73 0.76
74 0.75
75 0.74
76 0.7
77 0.66
78 0.61
79 0.59
80 0.59
81 0.53
82 0.44
83 0.35
84 0.31
85 0.25
86 0.21
87 0.19