Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BNH2

Protein Details
Accession G8BNH2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MVAPRETKKRTTRRKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
7-23TKKRTTRRKKDPNAPKR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG tpf:TPHA_0A03740  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MVAPRETKKRTTRRKKDPNAPKRALSAYMFFANETRDIVKAENPDVSFGQVGRILGEKWKALTAEEKIPFEAKAEADKKRYESEKALYNATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.94
4 0.95
5 0.94
6 0.93
7 0.87
8 0.78
9 0.71
10 0.63
11 0.56
12 0.47
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.19
19 0.16
20 0.15
21 0.13
22 0.11
23 0.09
24 0.1
25 0.1
26 0.13
27 0.13
28 0.14
29 0.16
30 0.15
31 0.16
32 0.15
33 0.15
34 0.12
35 0.1
36 0.1
37 0.08
38 0.08
39 0.07
40 0.08
41 0.07
42 0.09
43 0.11
44 0.1
45 0.1
46 0.12
47 0.11
48 0.12
49 0.16
50 0.17
51 0.23
52 0.25
53 0.26
54 0.25
55 0.26
56 0.25
57 0.22
58 0.21
59 0.14
60 0.2
61 0.24
62 0.28
63 0.31
64 0.35
65 0.37
66 0.42
67 0.45
68 0.41
69 0.42
70 0.43
71 0.47
72 0.47
73 0.5