Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3GPE3

Protein Details
Accession A0A2H3GPE3    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-29ITIKPKPTTKMQPRLERLQPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 7.5, cyto_nucl 6.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046348  SIS_dom_sf  
Gene Ontology GO:0097367  F:carbohydrate derivative binding  
GO:1901135  P:carbohydrate derivative metabolic process  
Amino Acid Sequences MPLCDLSNFITIKPKPTTKMQPRLERLQPMLGNPLFESILWGHEYDLSRLNTDLRQRIESGQFKRLVFYGMGCSSVVSDIVKGFFLNEKIPLHVQVINDYDLDWFVDRNVMKDPTTLAIIVCYSGWSVEPCLFFETMREMTGNKNLIVLSGGGKIAHLCEEHNTSTILYKLRHADREYPLYHVQQFFSIFLDLFHKLKLTPCSYHKELQDSVNFLKTEFNEATLKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.48
4 0.58
5 0.6
6 0.69
7 0.72
8 0.76
9 0.78
10 0.82
11 0.8
12 0.75
13 0.68
14 0.65
15 0.57
16 0.48
17 0.49
18 0.41
19 0.36
20 0.29
21 0.28
22 0.2
23 0.18
24 0.19
25 0.11
26 0.13
27 0.13
28 0.13
29 0.11
30 0.15
31 0.17
32 0.16
33 0.21
34 0.2
35 0.2
36 0.21
37 0.22
38 0.22
39 0.26
40 0.31
41 0.28
42 0.29
43 0.29
44 0.33
45 0.39
46 0.43
47 0.42
48 0.43
49 0.44
50 0.42
51 0.42
52 0.38
53 0.32
54 0.24
55 0.21
56 0.19
57 0.14
58 0.15
59 0.14
60 0.14
61 0.12
62 0.12
63 0.11
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.08
72 0.09
73 0.1
74 0.12
75 0.12
76 0.14
77 0.15
78 0.15
79 0.15
80 0.16
81 0.16
82 0.15
83 0.16
84 0.15
85 0.15
86 0.14
87 0.12
88 0.09
89 0.09
90 0.07
91 0.05
92 0.04
93 0.08
94 0.08
95 0.09
96 0.12
97 0.13
98 0.13
99 0.13
100 0.14
101 0.11
102 0.11
103 0.1
104 0.08
105 0.06
106 0.06
107 0.06
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.06
115 0.08
116 0.09
117 0.09
118 0.11
119 0.11
120 0.11
121 0.11
122 0.14
123 0.12
124 0.12
125 0.12
126 0.11
127 0.12
128 0.17
129 0.18
130 0.14
131 0.14
132 0.14
133 0.13
134 0.13
135 0.12
136 0.09
137 0.08
138 0.08
139 0.07
140 0.07
141 0.07
142 0.07
143 0.08
144 0.07
145 0.07
146 0.09
147 0.13
148 0.14
149 0.15
150 0.15
151 0.14
152 0.15
153 0.17
154 0.18
155 0.15
156 0.18
157 0.24
158 0.28
159 0.33
160 0.35
161 0.4
162 0.42
163 0.49
164 0.46
165 0.45
166 0.44
167 0.41
168 0.42
169 0.37
170 0.32
171 0.27
172 0.28
173 0.23
174 0.21
175 0.18
176 0.14
177 0.13
178 0.16
179 0.16
180 0.15
181 0.15
182 0.14
183 0.14
184 0.19
185 0.26
186 0.27
187 0.31
188 0.36
189 0.44
190 0.48
191 0.53
192 0.52
193 0.51
194 0.49
195 0.49
196 0.49
197 0.46
198 0.43
199 0.43
200 0.4
201 0.34
202 0.36
203 0.31
204 0.32
205 0.27
206 0.28
207 0.28