Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3H5Y4

Protein Details
Accession A0A2H3H5Y4   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
68-88QEPSRRRKSRHTSSRDSDRHSBasic
NLS Segment(s)
PositionSequence
73-76RRKS
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
Amino Acid Sequences MYECYRDHNGYTCLVLVNGREYQTDLAYESDVLAQENAAMRAFMVCRNFSVNGGMLARNGIVQGLPAQEPSRRRKSRHTSSRDSDRHSRRSGHHSSSSSTASFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.13
4 0.14
5 0.15
6 0.15
7 0.14
8 0.15
9 0.16
10 0.16
11 0.15
12 0.13
13 0.11
14 0.11
15 0.1
16 0.09
17 0.09
18 0.08
19 0.08
20 0.07
21 0.06
22 0.06
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.07
29 0.07
30 0.09
31 0.1
32 0.09
33 0.1
34 0.13
35 0.13
36 0.13
37 0.13
38 0.11
39 0.11
40 0.11
41 0.11
42 0.08
43 0.08
44 0.07
45 0.06
46 0.06
47 0.04
48 0.03
49 0.03
50 0.05
51 0.06
52 0.06
53 0.07
54 0.08
55 0.12
56 0.18
57 0.26
58 0.36
59 0.41
60 0.45
61 0.55
62 0.64
63 0.72
64 0.77
65 0.78
66 0.76
67 0.79
68 0.86
69 0.81
70 0.78
71 0.77
72 0.75
73 0.74
74 0.69
75 0.67
76 0.62
77 0.65
78 0.66
79 0.63
80 0.63
81 0.58
82 0.57
83 0.55
84 0.52