Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3G4M2

Protein Details
Accession A0A2H3G4M2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-70GCLSRIRKIKSRVREKRSEATRRGBasic
NLS Segment(s)
PositionSequence
53-64RKIKSRVREKRS
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MRVASSLMTLMKQEKKLENDEDEASEDLLRLYEEMAALQSRLAAAAGCLSRIRKIKSRVREKRSEATRRGLQEVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.43
4 0.46
5 0.43
6 0.41
7 0.38
8 0.35
9 0.3
10 0.26
11 0.21
12 0.16
13 0.13
14 0.09
15 0.08
16 0.07
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.03
31 0.03
32 0.06
33 0.06
34 0.07
35 0.08
36 0.09
37 0.14
38 0.2
39 0.24
40 0.29
41 0.39
42 0.47
43 0.56
44 0.67
45 0.73
46 0.76
47 0.82
48 0.81
49 0.82
50 0.83
51 0.83
52 0.77
53 0.75
54 0.74
55 0.68