Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3HH84

Protein Details
Accession A0A2H3HH84   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTPEKFQRHLKPRLPPFDSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR000477  RT_dom  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF00078  RVT_1  
PROSITE View protein in PROSITE  
PS50878  RT_POL  
Amino Acid Sequences MTPEKFQRHLKPRLPPFDSPVGSEEQVADLFAKEVLRSQASSSSIKQLASKLGKRLVELDTFKKKVQTPKTLQRISFLERDLDRLNAEMWNVSNHDKTRRTSPRELFNMFRLARGRPQPIQFAQTPTLEYKGDHHSDSDAANETQLATTDHEKIEMIKKVKFRNNDNPKSKRILDESGARHDPQREDINMPRDIDAEKLRTIIRGLQNNKAPGPYQVPNEAIKLGMELLLPYFLLGFRACLNLSLHPTNFKDSIIVMLLKAGEEVDKPESYRPISLLSTVSKLCERILADMMLDVLKENPHFLLATQFGNKTTTEALQYLFRIIYGTWCSRSNDVVTILGLDMSSAYDNFYRQKLLQTLYDKDFPKWFVDIIGRVLSLRDATLRLPGIISERFGMNTGIPQGLPLSTVLFSLFLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.75
3 0.72
4 0.71
5 0.65
6 0.57
7 0.49
8 0.44
9 0.38
10 0.34
11 0.28
12 0.2
13 0.19
14 0.16
15 0.14
16 0.1
17 0.1
18 0.1
19 0.1
20 0.09
21 0.12
22 0.15
23 0.17
24 0.17
25 0.19
26 0.23
27 0.26
28 0.3
29 0.29
30 0.33
31 0.33
32 0.33
33 0.33
34 0.31
35 0.36
36 0.41
37 0.44
38 0.43
39 0.47
40 0.47
41 0.46
42 0.47
43 0.41
44 0.4
45 0.4
46 0.42
47 0.45
48 0.47
49 0.47
50 0.49
51 0.51
52 0.53
53 0.58
54 0.6
55 0.6
56 0.68
57 0.77
58 0.78
59 0.73
60 0.69
61 0.64
62 0.58
63 0.53
64 0.44
65 0.4
66 0.33
67 0.37
68 0.33
69 0.29
70 0.24
71 0.2
72 0.2
73 0.15
74 0.15
75 0.12
76 0.11
77 0.12
78 0.14
79 0.16
80 0.19
81 0.21
82 0.29
83 0.32
84 0.35
85 0.43
86 0.51
87 0.57
88 0.62
89 0.66
90 0.67
91 0.69
92 0.71
93 0.63
94 0.57
95 0.57
96 0.47
97 0.45
98 0.37
99 0.32
100 0.35
101 0.39
102 0.41
103 0.37
104 0.4
105 0.43
106 0.43
107 0.46
108 0.41
109 0.39
110 0.36
111 0.32
112 0.31
113 0.25
114 0.25
115 0.21
116 0.19
117 0.18
118 0.22
119 0.23
120 0.21
121 0.21
122 0.2
123 0.2
124 0.2
125 0.19
126 0.15
127 0.13
128 0.12
129 0.11
130 0.11
131 0.09
132 0.1
133 0.09
134 0.08
135 0.1
136 0.13
137 0.13
138 0.13
139 0.13
140 0.15
141 0.19
142 0.23
143 0.24
144 0.25
145 0.31
146 0.38
147 0.44
148 0.48
149 0.5
150 0.55
151 0.64
152 0.7
153 0.74
154 0.72
155 0.7
156 0.7
157 0.64
158 0.56
159 0.5
160 0.43
161 0.37
162 0.39
163 0.38
164 0.38
165 0.38
166 0.35
167 0.32
168 0.31
169 0.29
170 0.25
171 0.26
172 0.22
173 0.24
174 0.28
175 0.31
176 0.3
177 0.3
178 0.26
179 0.23
180 0.21
181 0.2
182 0.18
183 0.15
184 0.13
185 0.14
186 0.14
187 0.13
188 0.14
189 0.17
190 0.19
191 0.25
192 0.27
193 0.31
194 0.34
195 0.36
196 0.35
197 0.3
198 0.26
199 0.2
200 0.23
201 0.2
202 0.19
203 0.2
204 0.21
205 0.21
206 0.22
207 0.2
208 0.15
209 0.12
210 0.1
211 0.08
212 0.06
213 0.05
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.03
221 0.04
222 0.04
223 0.05
224 0.05
225 0.07
226 0.07
227 0.09
228 0.1
229 0.11
230 0.16
231 0.17
232 0.17
233 0.2
234 0.21
235 0.22
236 0.22
237 0.2
238 0.16
239 0.14
240 0.15
241 0.13
242 0.12
243 0.08
244 0.08
245 0.08
246 0.08
247 0.07
248 0.06
249 0.05
250 0.05
251 0.07
252 0.09
253 0.1
254 0.11
255 0.13
256 0.16
257 0.17
258 0.17
259 0.16
260 0.16
261 0.16
262 0.17
263 0.17
264 0.16
265 0.18
266 0.17
267 0.18
268 0.16
269 0.16
270 0.14
271 0.15
272 0.15
273 0.15
274 0.16
275 0.15
276 0.14
277 0.13
278 0.13
279 0.1
280 0.09
281 0.07
282 0.06
283 0.07
284 0.07
285 0.08
286 0.07
287 0.08
288 0.08
289 0.08
290 0.12
291 0.13
292 0.15
293 0.17
294 0.17
295 0.17
296 0.19
297 0.19
298 0.16
299 0.16
300 0.15
301 0.14
302 0.15
303 0.15
304 0.16
305 0.17
306 0.16
307 0.15
308 0.13
309 0.12
310 0.11
311 0.14
312 0.16
313 0.19
314 0.2
315 0.23
316 0.26
317 0.26
318 0.29
319 0.26
320 0.24
321 0.23
322 0.21
323 0.18
324 0.17
325 0.15
326 0.13
327 0.11
328 0.07
329 0.06
330 0.06
331 0.06
332 0.05
333 0.07
334 0.08
335 0.1
336 0.13
337 0.15
338 0.17
339 0.18
340 0.24
341 0.27
342 0.29
343 0.35
344 0.37
345 0.42
346 0.43
347 0.5
348 0.45
349 0.43
350 0.45
351 0.39
352 0.37
353 0.32
354 0.28
355 0.24
356 0.27
357 0.27
358 0.26
359 0.25
360 0.22
361 0.21
362 0.21
363 0.18
364 0.14
365 0.13
366 0.12
367 0.11
368 0.12
369 0.17
370 0.18
371 0.17
372 0.17
373 0.17
374 0.2
375 0.2
376 0.21
377 0.17
378 0.17
379 0.17
380 0.18
381 0.19
382 0.14
383 0.16
384 0.18
385 0.17
386 0.16
387 0.16
388 0.16
389 0.14
390 0.14
391 0.11
392 0.11
393 0.1
394 0.11
395 0.11
396 0.1