Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3HFL8

Protein Details
Accession A0A2H3HFL8    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-117RNAARAKRDKIREQQRELGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MEPPAWSVHSRPKIQSPQPVTITGFLSGSSNSIQYINIIMHPHLHTKNALACEEVIAALEQCHSQGFMHKAVGSCNDAKEKVNECLKIERSKMQAENRNAARAKRDKIREQQRELGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.63
4 0.63
5 0.61
6 0.6
7 0.52
8 0.45
9 0.4
10 0.3
11 0.24
12 0.16
13 0.15
14 0.12
15 0.11
16 0.1
17 0.08
18 0.08
19 0.09
20 0.08
21 0.08
22 0.09
23 0.08
24 0.09
25 0.1
26 0.09
27 0.12
28 0.13
29 0.18
30 0.17
31 0.18
32 0.17
33 0.18
34 0.21
35 0.2
36 0.19
37 0.14
38 0.14
39 0.13
40 0.12
41 0.1
42 0.07
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.08
53 0.11
54 0.12
55 0.13
56 0.14
57 0.14
58 0.15
59 0.18
60 0.17
61 0.15
62 0.16
63 0.18
64 0.18
65 0.19
66 0.23
67 0.24
68 0.27
69 0.32
70 0.32
71 0.32
72 0.38
73 0.41
74 0.42
75 0.41
76 0.41
77 0.39
78 0.43
79 0.47
80 0.49
81 0.54
82 0.53
83 0.59
84 0.57
85 0.6
86 0.57
87 0.52
88 0.53
89 0.51
90 0.53
91 0.53
92 0.59
93 0.61
94 0.69
95 0.78
96 0.79
97 0.79