Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3G6Q8

Protein Details
Accession A0A2H3G6Q8   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MARNRYSQTRKNDRKPLRIFQANVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
Amino Acid Sequences MARNRYSQTRKNDRKPLRIFQANVGKIPPAHDCALALADSERYDIVLLQEPWTAHTETRSLTKTHPAYNTLTPVDMWNSNDTRPRVMTYVRRDPRLVADQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.85
4 0.84
5 0.81
6 0.72
7 0.7
8 0.71
9 0.62
10 0.55
11 0.47
12 0.38
13 0.3
14 0.31
15 0.24
16 0.18
17 0.17
18 0.16
19 0.15
20 0.15
21 0.15
22 0.13
23 0.11
24 0.07
25 0.07
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.05
32 0.06
33 0.1
34 0.1
35 0.1
36 0.12
37 0.12
38 0.13
39 0.15
40 0.14
41 0.1
42 0.11
43 0.11
44 0.11
45 0.15
46 0.15
47 0.15
48 0.15
49 0.24
50 0.25
51 0.29
52 0.3
53 0.29
54 0.31
55 0.33
56 0.35
57 0.28
58 0.25
59 0.21
60 0.2
61 0.2
62 0.18
63 0.17
64 0.18
65 0.19
66 0.21
67 0.28
68 0.28
69 0.29
70 0.29
71 0.3
72 0.28
73 0.33
74 0.39
75 0.42
76 0.52
77 0.55
78 0.57
79 0.56
80 0.55
81 0.56