Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3GSW0

Protein Details
Accession A0A2H3GSW0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
7-31QLVILPKKVKWQRASRPKVRTGCLTHydrophilic
42-63KCDEEKPTCRRCRDGRVKCDGYBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 9.5, cyto_nucl 8.833, cyto_mito 7.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
CDD cd00067  GAL4  
Amino Acid Sequences MTTSTNQLVILPKKVKWQRASRPKVRTGCLTCKYVFLVRHLKCDEEKPTCRRCRDGRVKCDGYATPTKNQIQQRASMPVTGYTVSSLNPRIADTSIENCYFHHFHHWTSTQLTCCPGSSNFYLTYVLPLAHSCEPIKHAIIAVGAAHRFYMAGQETCSPLQQLKSLAMQQYNKSIQRIIPHMSMDSAFDLQCTLVCCLLFVAFEGITGRYAESIRHIRAGTKLLSSPVLINSAKEQKMARKLTEMFANLGVEASMFLEDTIIPDIHSGCLDVLQCGDGSDQPFQDLDEAASFLRKLDVETVDIISQTPYTYSMNDDGRIEMCTLEGPEKQELEAKWEEMDAKFEVWSSRFELTKKHIATWECQELTSPQLTYLNLQQAFWRMGMSCGPEDLSEPTPDTAEAFLNAAEIFSQRLITPGQPSFSLDGDLISGLSVVVWSCTEGPHRARALDLLRRLNRREGIWDSKEIVEMHEAALALDDPKLWYNMEIPGGVPGYVAELAKISPRFGLHRSGLLIPDFECI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.61
4 0.68
5 0.7
6 0.77
7 0.86
8 0.85
9 0.87
10 0.88
11 0.87
12 0.81
13 0.8
14 0.77
15 0.76
16 0.72
17 0.68
18 0.59
19 0.54
20 0.52
21 0.48
22 0.42
23 0.4
24 0.44
25 0.41
26 0.49
27 0.48
28 0.48
29 0.46
30 0.5
31 0.51
32 0.51
33 0.57
34 0.57
35 0.66
36 0.71
37 0.73
38 0.75
39 0.74
40 0.76
41 0.79
42 0.8
43 0.79
44 0.81
45 0.8
46 0.72
47 0.7
48 0.6
49 0.56
50 0.55
51 0.5
52 0.44
53 0.48
54 0.5
55 0.52
56 0.56
57 0.58
58 0.51
59 0.53
60 0.52
61 0.51
62 0.49
63 0.44
64 0.38
65 0.31
66 0.3
67 0.25
68 0.21
69 0.15
70 0.14
71 0.13
72 0.16
73 0.16
74 0.16
75 0.16
76 0.16
77 0.17
78 0.17
79 0.19
80 0.18
81 0.2
82 0.23
83 0.23
84 0.23
85 0.21
86 0.27
87 0.25
88 0.23
89 0.28
90 0.25
91 0.26
92 0.34
93 0.35
94 0.32
95 0.34
96 0.37
97 0.3
98 0.3
99 0.31
100 0.24
101 0.22
102 0.23
103 0.2
104 0.21
105 0.21
106 0.22
107 0.2
108 0.21
109 0.22
110 0.19
111 0.2
112 0.16
113 0.14
114 0.12
115 0.11
116 0.14
117 0.14
118 0.16
119 0.14
120 0.15
121 0.17
122 0.19
123 0.2
124 0.16
125 0.15
126 0.14
127 0.14
128 0.12
129 0.11
130 0.11
131 0.1
132 0.09
133 0.08
134 0.07
135 0.07
136 0.07
137 0.1
138 0.11
139 0.11
140 0.12
141 0.14
142 0.16
143 0.17
144 0.17
145 0.13
146 0.12
147 0.13
148 0.14
149 0.14
150 0.14
151 0.17
152 0.2
153 0.22
154 0.25
155 0.27
156 0.26
157 0.32
158 0.35
159 0.34
160 0.32
161 0.31
162 0.28
163 0.3
164 0.32
165 0.29
166 0.26
167 0.24
168 0.24
169 0.23
170 0.21
171 0.17
172 0.15
173 0.12
174 0.09
175 0.08
176 0.08
177 0.07
178 0.08
179 0.09
180 0.08
181 0.08
182 0.08
183 0.08
184 0.08
185 0.08
186 0.07
187 0.06
188 0.06
189 0.05
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.06
197 0.07
198 0.07
199 0.11
200 0.16
201 0.16
202 0.19
203 0.19
204 0.19
205 0.22
206 0.25
207 0.21
208 0.18
209 0.18
210 0.16
211 0.16
212 0.15
213 0.14
214 0.11
215 0.14
216 0.12
217 0.12
218 0.14
219 0.2
220 0.2
221 0.21
222 0.22
223 0.23
224 0.32
225 0.34
226 0.32
227 0.3
228 0.31
229 0.31
230 0.34
231 0.3
232 0.22
233 0.2
234 0.19
235 0.14
236 0.12
237 0.1
238 0.06
239 0.05
240 0.04
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.04
247 0.05
248 0.05
249 0.05
250 0.05
251 0.06
252 0.06
253 0.06
254 0.06
255 0.04
256 0.06
257 0.06
258 0.06
259 0.06
260 0.06
261 0.06
262 0.06
263 0.06
264 0.06
265 0.07
266 0.09
267 0.08
268 0.09
269 0.09
270 0.09
271 0.09
272 0.08
273 0.06
274 0.05
275 0.06
276 0.06
277 0.06
278 0.06
279 0.05
280 0.06
281 0.06
282 0.06
283 0.09
284 0.1
285 0.1
286 0.11
287 0.12
288 0.11
289 0.11
290 0.11
291 0.08
292 0.07
293 0.06
294 0.06
295 0.06
296 0.07
297 0.07
298 0.09
299 0.13
300 0.14
301 0.15
302 0.15
303 0.14
304 0.14
305 0.15
306 0.13
307 0.09
308 0.08
309 0.07
310 0.08
311 0.09
312 0.1
313 0.11
314 0.12
315 0.13
316 0.13
317 0.17
318 0.16
319 0.2
320 0.2
321 0.18
322 0.16
323 0.17
324 0.18
325 0.14
326 0.17
327 0.12
328 0.11
329 0.1
330 0.11
331 0.12
332 0.11
333 0.13
334 0.13
335 0.15
336 0.17
337 0.17
338 0.22
339 0.26
340 0.34
341 0.33
342 0.32
343 0.35
344 0.34
345 0.38
346 0.39
347 0.41
348 0.33
349 0.32
350 0.3
351 0.26
352 0.28
353 0.25
354 0.19
355 0.12
356 0.14
357 0.14
358 0.15
359 0.18
360 0.22
361 0.21
362 0.21
363 0.21
364 0.23
365 0.24
366 0.22
367 0.19
368 0.12
369 0.13
370 0.14
371 0.16
372 0.13
373 0.12
374 0.13
375 0.12
376 0.13
377 0.16
378 0.16
379 0.14
380 0.15
381 0.15
382 0.15
383 0.15
384 0.14
385 0.12
386 0.1
387 0.1
388 0.09
389 0.08
390 0.08
391 0.08
392 0.07
393 0.06
394 0.06
395 0.06
396 0.06
397 0.07
398 0.06
399 0.08
400 0.1
401 0.11
402 0.17
403 0.17
404 0.19
405 0.19
406 0.21
407 0.21
408 0.2
409 0.2
410 0.14
411 0.13
412 0.11
413 0.11
414 0.09
415 0.06
416 0.06
417 0.04
418 0.04
419 0.04
420 0.03
421 0.04
422 0.04
423 0.05
424 0.06
425 0.08
426 0.11
427 0.17
428 0.2
429 0.26
430 0.28
431 0.28
432 0.28
433 0.32
434 0.36
435 0.38
436 0.42
437 0.45
438 0.5
439 0.56
440 0.59
441 0.6
442 0.57
443 0.52
444 0.52
445 0.5
446 0.52
447 0.5
448 0.5
449 0.46
450 0.43
451 0.44
452 0.38
453 0.32
454 0.25
455 0.21
456 0.18
457 0.17
458 0.15
459 0.12
460 0.12
461 0.11
462 0.09
463 0.09
464 0.09
465 0.08
466 0.1
467 0.11
468 0.11
469 0.12
470 0.13
471 0.17
472 0.18
473 0.17
474 0.16
475 0.18
476 0.18
477 0.17
478 0.15
479 0.11
480 0.12
481 0.13
482 0.12
483 0.09
484 0.09
485 0.1
486 0.16
487 0.18
488 0.16
489 0.17
490 0.19
491 0.24
492 0.26
493 0.33
494 0.3
495 0.33
496 0.36
497 0.36
498 0.36
499 0.33
500 0.32