Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3I305

Protein Details
Accession A0A2H3I305   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-61REWSGWGKTNKKNKKKAQKKANEKVADKVHydrophilic
NLS Segment(s)
PositionSequence
40-54KTNKKNKKKAQKKAN
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MCTVSLSCRTSLLPAQLLSSVGRGPGRLFVPCREWSGWGKTNKKNKKKAQKKANEKVADKVTEKVEVMQLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.21
5 0.18
6 0.16
7 0.12
8 0.1
9 0.1
10 0.1
11 0.09
12 0.12
13 0.13
14 0.15
15 0.16
16 0.17
17 0.21
18 0.23
19 0.26
20 0.23
21 0.24
22 0.24
23 0.29
24 0.33
25 0.36
26 0.42
27 0.46
28 0.56
29 0.64
30 0.71
31 0.75
32 0.78
33 0.82
34 0.86
35 0.89
36 0.89
37 0.9
38 0.91
39 0.92
40 0.92
41 0.89
42 0.8
43 0.77
44 0.72
45 0.67
46 0.57
47 0.51
48 0.43
49 0.38
50 0.36
51 0.31