Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3G7J6

Protein Details
Accession A0A2H3G7J6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MHRSTSARRRPSPRKITDPDLVHydrophilic
61-80QRSHSQSQRRRTHRHSTTPCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001670  ADH_Fe/GldA  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00465  Fe-ADH  
Amino Acid Sequences MHRSTSARRRPSPRKITDPDLVAIRAKFLNAPAVKGSALATPLATNLSPRCSHAGPSGTVQRSHSQSQRRRTHRHSTTPCVVVGPDVIHRLPSELGRLHLSSPLIISSPSRLNLARKIQTIISNLDSHVHCSSVVAIESCISGRDCVVSVGGVSAITLARTLGLCKGIPHICIPTTYSGSELHPGILSKSAIEKRNNDIAEHKTLPAVIIYDDNLTTTFPTRFSAPSHERVMDDLARARQSPKSDDVCWSYLHLPDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.82
4 0.78
5 0.71
6 0.63
7 0.55
8 0.48
9 0.41
10 0.34
11 0.29
12 0.23
13 0.2
14 0.18
15 0.16
16 0.23
17 0.2
18 0.23
19 0.22
20 0.23
21 0.22
22 0.21
23 0.21
24 0.14
25 0.14
26 0.12
27 0.11
28 0.09
29 0.1
30 0.11
31 0.1
32 0.11
33 0.12
34 0.16
35 0.16
36 0.18
37 0.23
38 0.22
39 0.25
40 0.28
41 0.3
42 0.27
43 0.31
44 0.37
45 0.34
46 0.35
47 0.35
48 0.35
49 0.35
50 0.39
51 0.41
52 0.43
53 0.48
54 0.57
55 0.65
56 0.69
57 0.73
58 0.76
59 0.8
60 0.79
61 0.82
62 0.79
63 0.77
64 0.74
65 0.67
66 0.6
67 0.5
68 0.41
69 0.3
70 0.23
71 0.16
72 0.11
73 0.11
74 0.11
75 0.11
76 0.11
77 0.12
78 0.12
79 0.11
80 0.13
81 0.12
82 0.13
83 0.15
84 0.15
85 0.15
86 0.16
87 0.15
88 0.12
89 0.11
90 0.1
91 0.08
92 0.08
93 0.07
94 0.08
95 0.1
96 0.1
97 0.12
98 0.13
99 0.15
100 0.21
101 0.27
102 0.28
103 0.27
104 0.28
105 0.28
106 0.3
107 0.29
108 0.26
109 0.21
110 0.18
111 0.17
112 0.19
113 0.17
114 0.17
115 0.15
116 0.13
117 0.1
118 0.1
119 0.1
120 0.07
121 0.08
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.06
128 0.05
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.04
137 0.04
138 0.05
139 0.04
140 0.03
141 0.04
142 0.03
143 0.03
144 0.03
145 0.03
146 0.04
147 0.04
148 0.05
149 0.06
150 0.07
151 0.08
152 0.08
153 0.14
154 0.14
155 0.15
156 0.16
157 0.17
158 0.16
159 0.17
160 0.18
161 0.16
162 0.17
163 0.16
164 0.16
165 0.15
166 0.16
167 0.17
168 0.16
169 0.13
170 0.12
171 0.12
172 0.11
173 0.13
174 0.12
175 0.1
176 0.16
177 0.22
178 0.27
179 0.31
180 0.34
181 0.37
182 0.45
183 0.45
184 0.4
185 0.39
186 0.38
187 0.4
188 0.39
189 0.34
190 0.26
191 0.25
192 0.24
193 0.2
194 0.16
195 0.09
196 0.09
197 0.09
198 0.1
199 0.1
200 0.1
201 0.1
202 0.09
203 0.1
204 0.12
205 0.12
206 0.11
207 0.13
208 0.15
209 0.16
210 0.19
211 0.27
212 0.3
213 0.36
214 0.4
215 0.4
216 0.38
217 0.39
218 0.41
219 0.33
220 0.3
221 0.29
222 0.29
223 0.29
224 0.3
225 0.31
226 0.31
227 0.33
228 0.36
229 0.39
230 0.4
231 0.4
232 0.45
233 0.48
234 0.45
235 0.41
236 0.4
237 0.35