Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AN00

Protein Details
Accession G3AN00   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
111-136VVQDWKMQRNKKLKFKYKTKTTVSVSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 4, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006976  VanZ-like  
Gene Ontology GO:0016020  C:membrane  
KEGG spaa:SPAPADRAFT_153310  -  
Pfam View protein in Pfam  
PF04892  VanZ  
Amino Acid Sequences MVSVRLPVLVLFILTLVGAGYLGFASIHLPYDKTIHFFTFTILTMEFYLIFNTKHKTSTILRLITFLVCTCGASISSEIIQNVVNPSRVFDVYDILFNMAGSLWGLIVCCVVQDWKMQRNKKLKFKYKTKTTVSVSPSSSITKKLEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.05
14 0.07
15 0.07
16 0.08
17 0.09
18 0.13
19 0.14
20 0.16
21 0.17
22 0.17
23 0.18
24 0.18
25 0.18
26 0.17
27 0.17
28 0.15
29 0.13
30 0.13
31 0.11
32 0.11
33 0.1
34 0.08
35 0.09
36 0.08
37 0.09
38 0.1
39 0.13
40 0.14
41 0.15
42 0.15
43 0.18
44 0.2
45 0.28
46 0.32
47 0.32
48 0.31
49 0.31
50 0.31
51 0.27
52 0.24
53 0.15
54 0.11
55 0.08
56 0.08
57 0.07
58 0.06
59 0.06
60 0.06
61 0.07
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.06
69 0.08
70 0.09
71 0.1
72 0.09
73 0.1
74 0.12
75 0.12
76 0.12
77 0.11
78 0.12
79 0.11
80 0.12
81 0.11
82 0.09
83 0.09
84 0.08
85 0.08
86 0.05
87 0.05
88 0.04
89 0.04
90 0.03
91 0.03
92 0.04
93 0.03
94 0.04
95 0.04
96 0.03
97 0.04
98 0.05
99 0.05
100 0.11
101 0.16
102 0.24
103 0.33
104 0.39
105 0.48
106 0.57
107 0.66
108 0.71
109 0.77
110 0.79
111 0.81
112 0.86
113 0.88
114 0.89
115 0.89
116 0.85
117 0.83
118 0.78
119 0.76
120 0.71
121 0.67
122 0.58
123 0.51
124 0.46
125 0.42
126 0.38
127 0.35
128 0.34