Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AM65

Protein Details
Accession G3AM65   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
168-189LASTPSPKKRRKPATPGSQSPSHydrophilic
NLS Segment(s)
PositionSequence
175-179KKRRK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007526  SWIRM  
IPR036388  WH-like_DNA-bd_sf  
KEGG spaa:SPAPADRAFT_137262  -  
Pfam View protein in Pfam  
PF04433  SWIRM  
PROSITE View protein in PROSITE  
PS50934  SWIRM  
Amino Acid Sequences MSLLYQPFTKAMMQRDIPGCLTPEQHSQLNITKGNTVNTDLIEPPLSPPLSPYQRNAVLHTVALPPPEYSTRKSYMSTNTPFRIENYKDYKLTIATSNNDKNSILKFIDRYSSKVNDERQRGLVMPLPVRKYKRRVYESDNDMSEETTRMRTRRVGGGPKSFDTDEELASTPSPKKRRKPATPGSQSPSLALQQQMLIDESIPDYSPDANETLPPNNTKCLRIEWKGQPMDLSSDPNLSKLHPAEVVLASILRLPVAVYLDSKRRLFFEKVARLKTGKQFRRTDAQKACRIDVNKASRLFAAFEKVGWLQDELFEKYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.42
4 0.4
5 0.36
6 0.33
7 0.28
8 0.29
9 0.25
10 0.3
11 0.31
12 0.32
13 0.31
14 0.33
15 0.36
16 0.39
17 0.39
18 0.34
19 0.35
20 0.34
21 0.36
22 0.33
23 0.31
24 0.26
25 0.24
26 0.25
27 0.2
28 0.2
29 0.19
30 0.17
31 0.15
32 0.19
33 0.19
34 0.16
35 0.18
36 0.25
37 0.31
38 0.34
39 0.35
40 0.37
41 0.43
42 0.45
43 0.46
44 0.41
45 0.35
46 0.32
47 0.32
48 0.27
49 0.21
50 0.21
51 0.18
52 0.14
53 0.16
54 0.22
55 0.22
56 0.23
57 0.27
58 0.3
59 0.32
60 0.33
61 0.35
62 0.37
63 0.43
64 0.46
65 0.47
66 0.46
67 0.46
68 0.45
69 0.43
70 0.43
71 0.38
72 0.4
73 0.4
74 0.42
75 0.41
76 0.41
77 0.4
78 0.33
79 0.31
80 0.27
81 0.23
82 0.22
83 0.28
84 0.32
85 0.32
86 0.32
87 0.3
88 0.28
89 0.26
90 0.27
91 0.2
92 0.18
93 0.18
94 0.18
95 0.25
96 0.24
97 0.26
98 0.27
99 0.3
100 0.31
101 0.35
102 0.41
103 0.42
104 0.45
105 0.45
106 0.41
107 0.39
108 0.36
109 0.32
110 0.28
111 0.24
112 0.23
113 0.25
114 0.26
115 0.3
116 0.34
117 0.38
118 0.42
119 0.46
120 0.51
121 0.53
122 0.55
123 0.58
124 0.63
125 0.63
126 0.6
127 0.53
128 0.44
129 0.38
130 0.33
131 0.26
132 0.18
133 0.13
134 0.12
135 0.14
136 0.14
137 0.15
138 0.18
139 0.2
140 0.26
141 0.31
142 0.35
143 0.37
144 0.43
145 0.44
146 0.42
147 0.42
148 0.35
149 0.29
150 0.25
151 0.21
152 0.15
153 0.14
154 0.14
155 0.11
156 0.11
157 0.13
158 0.13
159 0.18
160 0.26
161 0.32
162 0.39
163 0.5
164 0.6
165 0.67
166 0.74
167 0.78
168 0.81
169 0.82
170 0.8
171 0.75
172 0.68
173 0.59
174 0.5
175 0.41
176 0.31
177 0.24
178 0.18
179 0.14
180 0.1
181 0.11
182 0.1
183 0.09
184 0.08
185 0.07
186 0.07
187 0.07
188 0.06
189 0.06
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.08
196 0.08
197 0.1
198 0.12
199 0.14
200 0.16
201 0.18
202 0.19
203 0.24
204 0.25
205 0.25
206 0.25
207 0.29
208 0.34
209 0.35
210 0.42
211 0.44
212 0.51
213 0.5
214 0.49
215 0.43
216 0.37
217 0.38
218 0.31
219 0.27
220 0.19
221 0.21
222 0.21
223 0.22
224 0.22
225 0.18
226 0.21
227 0.19
228 0.2
229 0.16
230 0.17
231 0.18
232 0.18
233 0.17
234 0.13
235 0.12
236 0.1
237 0.1
238 0.09
239 0.06
240 0.05
241 0.05
242 0.06
243 0.08
244 0.09
245 0.1
246 0.14
247 0.2
248 0.26
249 0.27
250 0.27
251 0.28
252 0.33
253 0.35
254 0.39
255 0.43
256 0.48
257 0.55
258 0.57
259 0.59
260 0.56
261 0.58
262 0.6
263 0.61
264 0.59
265 0.61
266 0.63
267 0.65
268 0.73
269 0.71
270 0.72
271 0.71
272 0.72
273 0.7
274 0.68
275 0.66
276 0.62
277 0.6
278 0.56
279 0.55
280 0.54
281 0.53
282 0.5
283 0.49
284 0.44
285 0.43
286 0.39
287 0.32
288 0.3
289 0.23
290 0.22
291 0.24
292 0.23
293 0.23
294 0.22
295 0.21
296 0.15
297 0.19
298 0.23