Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3GGG3

Protein Details
Accession A0A2H3GGG3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
88-107SAPAKSNKNKGKKHNSSSGSHydrophilic
NLS Segment(s)
PositionSequence
91-101AKSNKNKGKKH
Subcellular Location(s) extr 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038903  Allergen_Asp_f_4  
Gene Ontology GO:0005576  C:extracellular region  
GO:0019863  F:IgE binding  
Amino Acid Sequences MKVSSSVVILAAALGVSAHPSGHAHQRAHAKRDFVVANKPVTVVEYATQVVTADAAPATAVPEAPASPKVDADTVPKAAASGPAPAASAPAKSNKNKGKKHNSSSGSGYKPFCGGKKAKRATLEDIAAKGNTGVPGDFGCNMMTVDEDVADKYDYTTTFKNDHDEDKECVCFNKIGPNGLIDGFFAKNVALTFTVPASSSQVVAFDSDSQGGCACASNKVPTTSDGQWASTWLEFDFGSERNKNWSGADASCLVSAAKNLNIPGLRVCDSDNTCSTINPGGTGKNAYLGGMEAEDGIGINTPAKQVRLTVDIDYSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.05
4 0.05
5 0.05
6 0.06
7 0.08
8 0.11
9 0.2
10 0.27
11 0.27
12 0.33
13 0.44
14 0.5
15 0.55
16 0.56
17 0.5
18 0.45
19 0.5
20 0.48
21 0.41
22 0.43
23 0.4
24 0.39
25 0.37
26 0.35
27 0.29
28 0.27
29 0.24
30 0.17
31 0.13
32 0.13
33 0.13
34 0.12
35 0.12
36 0.11
37 0.1
38 0.09
39 0.08
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.05
49 0.06
50 0.07
51 0.09
52 0.12
53 0.13
54 0.13
55 0.14
56 0.15
57 0.15
58 0.16
59 0.19
60 0.2
61 0.19
62 0.19
63 0.18
64 0.17
65 0.16
66 0.17
67 0.13
68 0.12
69 0.11
70 0.11
71 0.12
72 0.11
73 0.13
74 0.11
75 0.11
76 0.11
77 0.17
78 0.23
79 0.26
80 0.35
81 0.43
82 0.52
83 0.59
84 0.68
85 0.72
86 0.76
87 0.8
88 0.8
89 0.75
90 0.69
91 0.67
92 0.64
93 0.56
94 0.5
95 0.44
96 0.35
97 0.34
98 0.32
99 0.27
100 0.27
101 0.3
102 0.34
103 0.44
104 0.47
105 0.49
106 0.52
107 0.55
108 0.54
109 0.52
110 0.47
111 0.38
112 0.34
113 0.31
114 0.26
115 0.22
116 0.16
117 0.11
118 0.09
119 0.08
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.06
130 0.06
131 0.05
132 0.05
133 0.04
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.05
140 0.07
141 0.07
142 0.09
143 0.1
144 0.12
145 0.15
146 0.16
147 0.18
148 0.19
149 0.21
150 0.22
151 0.24
152 0.24
153 0.23
154 0.23
155 0.2
156 0.19
157 0.17
158 0.15
159 0.12
160 0.18
161 0.17
162 0.18
163 0.18
164 0.18
165 0.18
166 0.17
167 0.17
168 0.09
169 0.1
170 0.08
171 0.08
172 0.07
173 0.06
174 0.06
175 0.06
176 0.07
177 0.06
178 0.06
179 0.07
180 0.07
181 0.08
182 0.07
183 0.08
184 0.09
185 0.09
186 0.09
187 0.09
188 0.09
189 0.09
190 0.09
191 0.09
192 0.07
193 0.08
194 0.08
195 0.08
196 0.08
197 0.08
198 0.07
199 0.07
200 0.08
201 0.08
202 0.09
203 0.11
204 0.14
205 0.16
206 0.18
207 0.19
208 0.19
209 0.24
210 0.23
211 0.27
212 0.25
213 0.24
214 0.22
215 0.23
216 0.23
217 0.18
218 0.17
219 0.11
220 0.11
221 0.09
222 0.1
223 0.11
224 0.11
225 0.17
226 0.18
227 0.18
228 0.24
229 0.26
230 0.26
231 0.24
232 0.26
233 0.24
234 0.23
235 0.25
236 0.2
237 0.2
238 0.18
239 0.18
240 0.14
241 0.11
242 0.12
243 0.12
244 0.11
245 0.12
246 0.12
247 0.17
248 0.17
249 0.18
250 0.19
251 0.21
252 0.21
253 0.2
254 0.21
255 0.24
256 0.26
257 0.3
258 0.29
259 0.28
260 0.27
261 0.26
262 0.27
263 0.25
264 0.22
265 0.2
266 0.2
267 0.18
268 0.19
269 0.22
270 0.19
271 0.18
272 0.18
273 0.16
274 0.15
275 0.14
276 0.12
277 0.1
278 0.1
279 0.06
280 0.06
281 0.06
282 0.06
283 0.05
284 0.05
285 0.05
286 0.06
287 0.07
288 0.1
289 0.12
290 0.14
291 0.14
292 0.16
293 0.2
294 0.23
295 0.25
296 0.25