Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AL45

Protein Details
Accession G3AL45   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
129-172VLKERAQKVKQSKSKKSKRKKRKSKRRKKSRSKKIYKFAWHITEBasic
NLS Segment(s)
PositionSequence
133-162RAQKVKQSKSKKSKRKKRKSKRRKKSRSKK
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG spaa:SPAPADRAFT_60397  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MFDPLGVGIITNVMFKAIQNVRPAWSFIRPLTSTAVVSTIPKKNKMPPRPLWLVKEDEIKEVFIKGGTGAGGQKINKTNSKVQLTHLPTGIVVTCQYSRSQEQNRKRARELLALKLEELENPESCRNAVLKERAQKVKQSKSKKSKRKKRKSKRRKKSRSKKIYKFAWHITELYFLSSNQTTEVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.16
4 0.19
5 0.23
6 0.27
7 0.29
8 0.31
9 0.33
10 0.35
11 0.29
12 0.29
13 0.29
14 0.26
15 0.32
16 0.29
17 0.3
18 0.32
19 0.3
20 0.26
21 0.22
22 0.23
23 0.16
24 0.17
25 0.22
26 0.25
27 0.27
28 0.32
29 0.35
30 0.42
31 0.52
32 0.59
33 0.62
34 0.63
35 0.67
36 0.72
37 0.73
38 0.68
39 0.62
40 0.57
41 0.5
42 0.5
43 0.43
44 0.37
45 0.32
46 0.29
47 0.25
48 0.21
49 0.19
50 0.11
51 0.1
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.1
59 0.1
60 0.13
61 0.17
62 0.2
63 0.23
64 0.27
65 0.31
66 0.36
67 0.41
68 0.39
69 0.36
70 0.42
71 0.42
72 0.4
73 0.35
74 0.27
75 0.22
76 0.21
77 0.19
78 0.1
79 0.07
80 0.06
81 0.06
82 0.07
83 0.08
84 0.1
85 0.12
86 0.19
87 0.27
88 0.35
89 0.44
90 0.53
91 0.6
92 0.63
93 0.62
94 0.62
95 0.56
96 0.56
97 0.51
98 0.49
99 0.46
100 0.42
101 0.4
102 0.34
103 0.31
104 0.23
105 0.22
106 0.16
107 0.12
108 0.14
109 0.15
110 0.14
111 0.14
112 0.15
113 0.13
114 0.14
115 0.19
116 0.23
117 0.28
118 0.35
119 0.43
120 0.49
121 0.5
122 0.56
123 0.59
124 0.63
125 0.66
126 0.69
127 0.72
128 0.76
129 0.85
130 0.88
131 0.9
132 0.9
133 0.93
134 0.94
135 0.95
136 0.96
137 0.96
138 0.97
139 0.97
140 0.98
141 0.98
142 0.98
143 0.98
144 0.97
145 0.97
146 0.97
147 0.97
148 0.96
149 0.95
150 0.93
151 0.91
152 0.88
153 0.85
154 0.8
155 0.71
156 0.62
157 0.53
158 0.48
159 0.38
160 0.34
161 0.26
162 0.2
163 0.22
164 0.22
165 0.21