Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3HP29

Protein Details
Accession A0A2H3HP29    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
99-123EVYESPKVTPRKRRAPKTPESDSKAHydrophilic
NLS Segment(s)
PositionSequence
77-92AKKATSARKRGPKAKK
108-115PRKRRAPK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSDAAVKPNAWTDEAKNELLLRIIAQLKPEGKSINWSEINMEGRTVKSLQNQWTFFNKKLEAFKTQSNDGSAPSTPAKKATSARKRGPKAKKVAPDDDEVYESPKVTPRKRRAPKTPESDSKAVKKELSEAVVKDEEMEDDRDVDGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.28
4 0.27
5 0.25
6 0.23
7 0.21
8 0.13
9 0.14
10 0.16
11 0.16
12 0.17
13 0.21
14 0.22
15 0.23
16 0.25
17 0.22
18 0.19
19 0.26
20 0.27
21 0.3
22 0.29
23 0.28
24 0.27
25 0.3
26 0.33
27 0.26
28 0.24
29 0.17
30 0.16
31 0.18
32 0.18
33 0.16
34 0.18
35 0.23
36 0.3
37 0.35
38 0.36
39 0.37
40 0.44
41 0.46
42 0.43
43 0.42
44 0.37
45 0.33
46 0.37
47 0.37
48 0.34
49 0.34
50 0.35
51 0.33
52 0.34
53 0.31
54 0.28
55 0.25
56 0.2
57 0.19
58 0.15
59 0.14
60 0.14
61 0.14
62 0.12
63 0.15
64 0.15
65 0.16
66 0.21
67 0.29
68 0.38
69 0.45
70 0.53
71 0.6
72 0.66
73 0.72
74 0.77
75 0.75
76 0.73
77 0.72
78 0.73
79 0.7
80 0.7
81 0.63
82 0.58
83 0.51
84 0.44
85 0.39
86 0.3
87 0.27
88 0.2
89 0.18
90 0.15
91 0.19
92 0.24
93 0.3
94 0.4
95 0.46
96 0.57
97 0.67
98 0.76
99 0.81
100 0.83
101 0.86
102 0.84
103 0.84
104 0.82
105 0.8
106 0.76
107 0.71
108 0.69
109 0.65
110 0.59
111 0.51
112 0.43
113 0.4
114 0.39
115 0.36
116 0.32
117 0.28
118 0.3
119 0.3
120 0.29
121 0.25
122 0.21
123 0.19
124 0.18
125 0.2
126 0.15
127 0.15
128 0.15