Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3HBA5

Protein Details
Accession A0A2H3HBA5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-52AERYRARRGRHPPPGFDKWMBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006598  CAP10  
Pfam View protein in Pfam  
PF05686  Glyco_transf_90  
Amino Acid Sequences MGPKHPIKKLMADARARHESLLSKRSHDLYDAAERYRARRGRHPPPGFDKWMEAALASNSIVVEDYFDRIYKDLAPYWALDAHTLARRASAWHWVVKVRNGVATGVGDATDRVPWLELWTNLVEEFAKDLPDVDMPINYMDEPRLLVPFDELSKFVDQERDNRRIAPMKEVVTKFKTLSKLDDEKPQPYDPYWYNSSANYWELARVTCDPNAPSRNVQQVSDFKAPVEYPSNWDPEYAYKGYIKNWTAAQDPCLQPHLRQMHGSFVAPLSLSTSTELIPLFGGSKLPMNNEILIPGAMYLTADEFYSGGEKMGPAWHAKKTGIVWRGDASGGEPRADVWHRFHRHRLIQMLNGSYVDSVEHQGVKPKTFQLPNPDHYNSTHRTSNTIGQWLMQISDCGFKRLLCEKVGCDPVAPYYRELKHMTMKEQYRYKFLPDTDGNSFSARFRGFLRSSSMPLKATIYAEWHDDRLTPWVHFVPFDNTFQDLYPILEFFTDEEAGGDTAARFIAERGRDWASQVLRREDMRLYTWRLLLEWARVCDEDREKLGFIRDLIEPRKDSIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.69
3 0.62
4 0.53
5 0.47
6 0.46
7 0.46
8 0.49
9 0.43
10 0.4
11 0.44
12 0.47
13 0.45
14 0.4
15 0.34
16 0.31
17 0.39
18 0.38
19 0.35
20 0.37
21 0.36
22 0.37
23 0.44
24 0.44
25 0.4
26 0.47
27 0.55
28 0.61
29 0.71
30 0.76
31 0.75
32 0.79
33 0.81
34 0.77
35 0.7
36 0.62
37 0.53
38 0.47
39 0.38
40 0.29
41 0.22
42 0.17
43 0.16
44 0.13
45 0.11
46 0.09
47 0.09
48 0.09
49 0.07
50 0.09
51 0.09
52 0.11
53 0.11
54 0.12
55 0.13
56 0.13
57 0.15
58 0.16
59 0.18
60 0.19
61 0.21
62 0.22
63 0.21
64 0.23
65 0.24
66 0.21
67 0.18
68 0.16
69 0.18
70 0.21
71 0.22
72 0.2
73 0.18
74 0.18
75 0.21
76 0.21
77 0.26
78 0.25
79 0.27
80 0.3
81 0.33
82 0.36
83 0.39
84 0.42
85 0.34
86 0.33
87 0.3
88 0.28
89 0.25
90 0.22
91 0.17
92 0.12
93 0.11
94 0.09
95 0.08
96 0.08
97 0.08
98 0.07
99 0.07
100 0.08
101 0.07
102 0.12
103 0.15
104 0.15
105 0.17
106 0.18
107 0.18
108 0.17
109 0.18
110 0.14
111 0.1
112 0.12
113 0.1
114 0.09
115 0.09
116 0.09
117 0.1
118 0.1
119 0.12
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.09
126 0.1
127 0.08
128 0.08
129 0.09
130 0.09
131 0.09
132 0.09
133 0.09
134 0.1
135 0.11
136 0.12
137 0.12
138 0.12
139 0.14
140 0.15
141 0.15
142 0.15
143 0.2
144 0.19
145 0.27
146 0.34
147 0.37
148 0.36
149 0.37
150 0.4
151 0.41
152 0.41
153 0.39
154 0.37
155 0.35
156 0.42
157 0.43
158 0.45
159 0.4
160 0.41
161 0.35
162 0.35
163 0.36
164 0.3
165 0.33
166 0.35
167 0.38
168 0.39
169 0.47
170 0.45
171 0.43
172 0.46
173 0.43
174 0.37
175 0.31
176 0.34
177 0.27
178 0.29
179 0.29
180 0.28
181 0.27
182 0.26
183 0.27
184 0.23
185 0.22
186 0.17
187 0.14
188 0.13
189 0.12
190 0.12
191 0.12
192 0.13
193 0.14
194 0.15
195 0.16
196 0.16
197 0.21
198 0.24
199 0.24
200 0.25
201 0.26
202 0.33
203 0.32
204 0.32
205 0.3
206 0.31
207 0.36
208 0.37
209 0.33
210 0.25
211 0.26
212 0.25
213 0.22
214 0.23
215 0.17
216 0.18
217 0.2
218 0.23
219 0.21
220 0.22
221 0.2
222 0.17
223 0.22
224 0.18
225 0.17
226 0.17
227 0.18
228 0.2
229 0.25
230 0.24
231 0.21
232 0.21
233 0.22
234 0.22
235 0.22
236 0.22
237 0.23
238 0.22
239 0.22
240 0.24
241 0.22
242 0.2
243 0.27
244 0.28
245 0.23
246 0.24
247 0.24
248 0.25
249 0.25
250 0.25
251 0.18
252 0.14
253 0.13
254 0.11
255 0.1
256 0.07
257 0.06
258 0.06
259 0.07
260 0.07
261 0.07
262 0.08
263 0.08
264 0.06
265 0.06
266 0.06
267 0.06
268 0.05
269 0.06
270 0.05
271 0.07
272 0.08
273 0.09
274 0.1
275 0.1
276 0.11
277 0.11
278 0.11
279 0.09
280 0.08
281 0.07
282 0.05
283 0.04
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.03
290 0.03
291 0.03
292 0.04
293 0.05
294 0.05
295 0.05
296 0.05
297 0.05
298 0.05
299 0.07
300 0.08
301 0.1
302 0.12
303 0.14
304 0.16
305 0.16
306 0.18
307 0.19
308 0.25
309 0.27
310 0.26
311 0.25
312 0.24
313 0.25
314 0.23
315 0.2
316 0.14
317 0.14
318 0.14
319 0.13
320 0.12
321 0.11
322 0.14
323 0.16
324 0.17
325 0.17
326 0.26
327 0.32
328 0.35
329 0.4
330 0.45
331 0.48
332 0.51
333 0.53
334 0.46
335 0.45
336 0.46
337 0.41
338 0.33
339 0.28
340 0.24
341 0.17
342 0.14
343 0.1
344 0.07
345 0.07
346 0.08
347 0.09
348 0.09
349 0.16
350 0.18
351 0.19
352 0.2
353 0.22
354 0.28
355 0.3
356 0.33
357 0.35
358 0.41
359 0.44
360 0.49
361 0.48
362 0.43
363 0.42
364 0.45
365 0.39
366 0.36
367 0.36
368 0.29
369 0.31
370 0.32
371 0.36
372 0.32
373 0.32
374 0.27
375 0.23
376 0.24
377 0.22
378 0.2
379 0.13
380 0.11
381 0.08
382 0.15
383 0.14
384 0.15
385 0.15
386 0.15
387 0.2
388 0.25
389 0.27
390 0.24
391 0.26
392 0.26
393 0.32
394 0.35
395 0.31
396 0.25
397 0.23
398 0.25
399 0.28
400 0.27
401 0.23
402 0.27
403 0.29
404 0.33
405 0.36
406 0.34
407 0.37
408 0.39
409 0.41
410 0.42
411 0.45
412 0.48
413 0.53
414 0.51
415 0.49
416 0.47
417 0.48
418 0.45
419 0.41
420 0.41
421 0.37
422 0.4
423 0.38
424 0.39
425 0.36
426 0.31
427 0.31
428 0.23
429 0.26
430 0.21
431 0.17
432 0.17
433 0.24
434 0.24
435 0.26
436 0.32
437 0.3
438 0.34
439 0.37
440 0.37
441 0.3
442 0.3
443 0.3
444 0.25
445 0.24
446 0.21
447 0.21
448 0.19
449 0.22
450 0.22
451 0.21
452 0.2
453 0.19
454 0.19
455 0.2
456 0.21
457 0.17
458 0.19
459 0.22
460 0.22
461 0.22
462 0.23
463 0.25
464 0.26
465 0.27
466 0.26
467 0.24
468 0.24
469 0.23
470 0.23
471 0.17
472 0.16
473 0.14
474 0.13
475 0.11
476 0.1
477 0.1
478 0.09
479 0.12
480 0.11
481 0.1
482 0.1
483 0.11
484 0.11
485 0.11
486 0.1
487 0.07
488 0.07
489 0.07
490 0.06
491 0.06
492 0.07
493 0.13
494 0.15
495 0.17
496 0.21
497 0.25
498 0.26
499 0.28
500 0.34
501 0.34
502 0.37
503 0.42
504 0.43
505 0.43
506 0.44
507 0.44
508 0.41
509 0.38
510 0.37
511 0.38
512 0.39
513 0.39
514 0.4
515 0.38
516 0.35
517 0.36
518 0.34
519 0.35
520 0.34
521 0.32
522 0.33
523 0.33
524 0.34
525 0.37
526 0.39
527 0.37
528 0.35
529 0.36
530 0.34
531 0.36
532 0.39
533 0.34
534 0.3
535 0.27
536 0.28
537 0.33
538 0.36
539 0.41
540 0.38