Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3GFU3

Protein Details
Accession A0A2H3GFU3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-110EDLHEKHSRKKESHKRDPSKKHSHKKESRKKDSPKKRQPBasic
NLS Segment(s)
PositionSequence
65-110KKRVRFKEDLHEKHSRKKESHKRDPSKKHSHKKESRKKDSPKKRQP
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEDNNASGSNTIKKGAAEELPENVAQNMPKLLAKGESEEGHSESEEEQSQEDGSEEDEPKNDGTKKRVRFKEDLHEKHSRKKESHKRDPSKKHSHKKESRKKDSPKKRQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.22
4 0.21
5 0.21
6 0.22
7 0.23
8 0.23
9 0.21
10 0.18
11 0.17
12 0.13
13 0.12
14 0.11
15 0.1
16 0.11
17 0.1
18 0.11
19 0.12
20 0.12
21 0.14
22 0.16
23 0.16
24 0.17
25 0.18
26 0.18
27 0.16
28 0.15
29 0.13
30 0.11
31 0.12
32 0.1
33 0.09
34 0.08
35 0.08
36 0.08
37 0.07
38 0.07
39 0.06
40 0.06
41 0.08
42 0.08
43 0.08
44 0.09
45 0.09
46 0.1
47 0.13
48 0.16
49 0.16
50 0.22
51 0.3
52 0.38
53 0.47
54 0.53
55 0.56
56 0.59
57 0.61
58 0.66
59 0.69
60 0.66
61 0.63
62 0.66
63 0.62
64 0.66
65 0.7
66 0.65
67 0.59
68 0.65
69 0.69
70 0.7
71 0.79
72 0.81
73 0.83
74 0.88
75 0.93
76 0.92
77 0.93
78 0.93
79 0.93
80 0.92
81 0.93
82 0.93
83 0.93
84 0.94
85 0.94
86 0.94
87 0.93
88 0.94
89 0.94
90 0.95