Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BQT5

Protein Details
Accession G8BQT5    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-26HTAHNQTKKAHRNGIKKPRTBasic
NLS Segment(s)
PositionSequence
14-62KKAHRNGIKKPRTYKYPSLKGVDPKFKRNHKHALHGTQKALAAKRAAKN
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tpf:TPHA_0C04460  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTAHNQTKKAHRNGIKKPRTYKYPSLKGVDPKFKRNHKHALHGTQKALAAKRAAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.76
3 0.75
4 0.72
5 0.72
6 0.75
7 0.8
8 0.79
9 0.77
10 0.78
11 0.75
12 0.74
13 0.72
14 0.71
15 0.69
16 0.7
17 0.67
18 0.63
19 0.6
20 0.61
21 0.6
22 0.6
23 0.53
24 0.53
25 0.57
26 0.61
27 0.65
28 0.64
29 0.68
30 0.62
31 0.7
32 0.7
33 0.72
34 0.72
35 0.7
36 0.65
37 0.58
38 0.56
39 0.5
40 0.44
41 0.38
42 0.34