Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3HFW8

Protein Details
Accession A0A2H3HFW8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
110-130DYEAKKAKKDERRAARRQEEEBasic
NLS Segment(s)
PositionSequence
114-153KKAKKDERRAARRQEEENQRLEEKRLENEKKEAKRKAWEE
Subcellular Location(s) nucl 11.5, cyto_nucl 10.333, cyto_mito 8.333, cyto 8, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MSSPVAKAARRVTHELHGVVVSAGLMDKTVKVRVGGQKWNKIVNKWFADPKHYLVHDPNSSLRTGDVVSIVPGWPTSQHKRHVIKHIIAPYGTPITERPPVPTLEERIADYEAKKAKKDERRAARRQEEENQRLEEKRLENEKKEAKRKAWEEAQQKRKPQTSASDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.46
3 0.4
4 0.33
5 0.28
6 0.22
7 0.18
8 0.11
9 0.07
10 0.06
11 0.04
12 0.05
13 0.05
14 0.06
15 0.08
16 0.11
17 0.12
18 0.12
19 0.19
20 0.27
21 0.33
22 0.41
23 0.47
24 0.53
25 0.55
26 0.62
27 0.59
28 0.54
29 0.55
30 0.54
31 0.51
32 0.46
33 0.5
34 0.43
35 0.46
36 0.44
37 0.41
38 0.39
39 0.35
40 0.34
41 0.31
42 0.36
43 0.32
44 0.31
45 0.3
46 0.25
47 0.25
48 0.22
49 0.18
50 0.13
51 0.12
52 0.1
53 0.08
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.05
61 0.07
62 0.12
63 0.19
64 0.23
65 0.28
66 0.37
67 0.43
68 0.49
69 0.56
70 0.56
71 0.52
72 0.51
73 0.5
74 0.43
75 0.37
76 0.31
77 0.24
78 0.19
79 0.16
80 0.12
81 0.09
82 0.11
83 0.15
84 0.16
85 0.17
86 0.18
87 0.19
88 0.22
89 0.24
90 0.24
91 0.23
92 0.24
93 0.21
94 0.21
95 0.22
96 0.19
97 0.17
98 0.19
99 0.22
100 0.23
101 0.24
102 0.27
103 0.34
104 0.42
105 0.52
106 0.57
107 0.62
108 0.7
109 0.77
110 0.83
111 0.84
112 0.8
113 0.76
114 0.75
115 0.75
116 0.7
117 0.65
118 0.59
119 0.53
120 0.49
121 0.46
122 0.43
123 0.35
124 0.37
125 0.43
126 0.46
127 0.46
128 0.54
129 0.61
130 0.64
131 0.71
132 0.71
133 0.67
134 0.71
135 0.71
136 0.71
137 0.7
138 0.69
139 0.7
140 0.73
141 0.78
142 0.75
143 0.79
144 0.79
145 0.76
146 0.7
147 0.66
148 0.64