Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3IB63

Protein Details
Accession A0A2H3IB63    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-39DGHRGHVEKRYNQRKRGKRAKPVGDYIHBasic
NLS Segment(s)
PositionSequence
21-32RYNQRKRGKRAK
Subcellular Location(s) nucl 14cyto_nucl 14, cyto 10
Family & Domain DBs
Amino Acid Sequences MLLEDVITKYVDGHRGHVEKRYNQRKRGKRAKPVGDYIHNVSLQELRDQQEEFIAEGLGTDRKAHIRNIRSIILGKIETLKEEWRANKEVIVNGGLKQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.35
4 0.4
5 0.44
6 0.46
7 0.56
8 0.63
9 0.64
10 0.69
11 0.78
12 0.8
13 0.84
14 0.87
15 0.86
16 0.85
17 0.87
18 0.87
19 0.83
20 0.8
21 0.75
22 0.69
23 0.62
24 0.55
25 0.49
26 0.39
27 0.33
28 0.26
29 0.23
30 0.18
31 0.17
32 0.16
33 0.13
34 0.14
35 0.15
36 0.14
37 0.12
38 0.12
39 0.1
40 0.09
41 0.07
42 0.05
43 0.05
44 0.06
45 0.06
46 0.05
47 0.06
48 0.06
49 0.1
50 0.12
51 0.17
52 0.24
53 0.28
54 0.34
55 0.38
56 0.39
57 0.38
58 0.37
59 0.33
60 0.29
61 0.25
62 0.19
63 0.19
64 0.17
65 0.17
66 0.18
67 0.19
68 0.2
69 0.26
70 0.3
71 0.31
72 0.35
73 0.34
74 0.36
75 0.37
76 0.35
77 0.32
78 0.3
79 0.26