Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BXR2

Protein Details
Accession G8BXR2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MSSTSQNRKDQPKVTKKRKILNLDSKEKRRNAHydrophilic
NLS Segment(s)
PositionSequence
16-19KKRK
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
KEGG tpf:TPHA_0I01860  -  
Pfam View protein in Pfam  
PF12622  NpwBP  
Amino Acid Sequences MSSTSQNRKDQPKVTKKRKILNLDSKEKRRNATNISAEKHLSSKESFGSDFDSESITNTQKHNTTNDVVKLGDKSIFYEEEWNPNGFAPLNVRNLSYNPSTFVRRGKEVITKLCGLQNIQIPKTHESKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.85
4 0.86
5 0.87
6 0.86
7 0.85
8 0.85
9 0.84
10 0.84
11 0.85
12 0.85
13 0.83
14 0.77
15 0.7
16 0.66
17 0.63
18 0.59
19 0.59
20 0.59
21 0.57
22 0.56
23 0.55
24 0.49
25 0.43
26 0.38
27 0.3
28 0.23
29 0.17
30 0.16
31 0.15
32 0.16
33 0.15
34 0.14
35 0.18
36 0.15
37 0.15
38 0.13
39 0.13
40 0.11
41 0.12
42 0.14
43 0.11
44 0.13
45 0.13
46 0.15
47 0.16
48 0.18
49 0.18
50 0.19
51 0.2
52 0.2
53 0.21
54 0.2
55 0.18
56 0.17
57 0.16
58 0.14
59 0.13
60 0.1
61 0.11
62 0.11
63 0.12
64 0.12
65 0.17
66 0.17
67 0.21
68 0.23
69 0.22
70 0.2
71 0.19
72 0.2
73 0.14
74 0.14
75 0.13
76 0.15
77 0.19
78 0.19
79 0.2
80 0.21
81 0.21
82 0.25
83 0.23
84 0.19
85 0.19
86 0.21
87 0.24
88 0.25
89 0.31
90 0.32
91 0.32
92 0.34
93 0.35
94 0.4
95 0.42
96 0.46
97 0.44
98 0.41
99 0.39
100 0.4
101 0.37
102 0.31
103 0.29
104 0.3
105 0.33
106 0.33
107 0.35
108 0.36
109 0.39