Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3GXC7

Protein Details
Accession A0A2H3GXC7    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-49KTRNTYCKGKECRKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, nucl 13.5, cyto 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MKGHELETTTPNLEPTILEGVNIPKTRNTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVKCKTKLQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.14
5 0.14
6 0.15
7 0.18
8 0.24
9 0.25
10 0.23
11 0.21
12 0.25
13 0.29
14 0.34
15 0.36
16 0.39
17 0.45
18 0.54
19 0.61
20 0.67
21 0.72
22 0.73
23 0.79
24 0.79
25 0.82
26 0.82
27 0.83
28 0.81
29 0.83
30 0.85
31 0.77
32 0.76
33 0.69
34 0.64
35 0.55
36 0.5
37 0.4
38 0.32
39 0.3
40 0.3
41 0.29
42 0.25
43 0.31
44 0.34
45 0.38
46 0.43
47 0.47
48 0.43
49 0.5
50 0.57
51 0.54
52 0.56
53 0.55
54 0.55
55 0.54
56 0.57
57 0.49
58 0.44
59 0.41
60 0.34
61 0.37
62 0.39
63 0.38
64 0.33
65 0.4
66 0.44
67 0.53
68 0.61
69 0.64
70 0.63
71 0.67
72 0.74
73 0.74
74 0.73
75 0.68
76 0.65
77 0.66
78 0.66
79 0.65
80 0.6
81 0.58
82 0.53
83 0.51
84 0.5
85 0.48
86 0.51
87 0.55
88 0.59
89 0.63
90 0.71
91 0.75
92 0.76
93 0.72
94 0.65
95 0.59
96 0.51
97 0.5
98 0.5
99 0.51
100 0.52
101 0.55
102 0.52
103 0.5
104 0.49
105 0.42