Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BYS4

Protein Details
Accession G8BYS4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-88VYSFILQQKKQKQEQQQLQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013965  DASH_Dad3  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0008608  P:attachment of spindle microtubules to kinetochore  
GO:0051301  P:cell division  
KEGG tpf:TPHA_0J01950  -  
Pfam View protein in Pfam  
PF08656  DASH_Dad3  
Amino Acid Sequences MPEELSPLQQDVLDRYSKLANILHSLDDTLNEINTSSTESRTSPEEVINEMREIEIKIGLVGTLLKGSVYSFILQQKKQKQEQQQLQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.19
5 0.2
6 0.19
7 0.17
8 0.19
9 0.2
10 0.19
11 0.17
12 0.18
13 0.15
14 0.13
15 0.13
16 0.1
17 0.08
18 0.07
19 0.07
20 0.06
21 0.07
22 0.09
23 0.08
24 0.09
25 0.1
26 0.1
27 0.12
28 0.14
29 0.15
30 0.13
31 0.14
32 0.14
33 0.14
34 0.16
35 0.16
36 0.14
37 0.12
38 0.11
39 0.1
40 0.1
41 0.08
42 0.07
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.06
56 0.07
57 0.08
58 0.11
59 0.19
60 0.25
61 0.29
62 0.37
63 0.45
64 0.53
65 0.6
66 0.66
67 0.69
68 0.74