Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3ICL5

Protein Details
Accession A0A2H3ICL5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
86-107ADNFAFKTTKKPHYKSWRCGPPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 11, pero 2
Family & Domain DBs
Amino Acid Sequences MAIEEEGTLEARADQCNPGINLIKLKIKPGKYFTGVGKPGKCYNLPANIKYFDVYSDDTKSLVSCFDCKVYTEANCKGSYVSIEGADNFAFKTTKKPHYKSWRCGPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.18
4 0.18
5 0.2
6 0.22
7 0.22
8 0.24
9 0.26
10 0.31
11 0.27
12 0.34
13 0.37
14 0.38
15 0.42
16 0.43
17 0.46
18 0.42
19 0.46
20 0.42
21 0.44
22 0.45
23 0.44
24 0.42
25 0.39
26 0.39
27 0.38
28 0.35
29 0.3
30 0.29
31 0.34
32 0.35
33 0.33
34 0.34
35 0.32
36 0.32
37 0.28
38 0.24
39 0.15
40 0.14
41 0.14
42 0.12
43 0.13
44 0.13
45 0.13
46 0.13
47 0.12
48 0.1
49 0.1
50 0.09
51 0.08
52 0.09
53 0.11
54 0.11
55 0.12
56 0.14
57 0.16
58 0.19
59 0.23
60 0.26
61 0.28
62 0.28
63 0.27
64 0.25
65 0.23
66 0.2
67 0.17
68 0.13
69 0.11
70 0.12
71 0.12
72 0.13
73 0.12
74 0.11
75 0.09
76 0.1
77 0.09
78 0.09
79 0.18
80 0.25
81 0.35
82 0.45
83 0.5
84 0.59
85 0.7
86 0.8
87 0.81