Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BTD6

Protein Details
Accession G8BTD6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
2-32ASSLPHPKIVKKHTKKFKRHHSDRYHRVGESBasic
NLS Segment(s)
PositionSequence
9-22KIVKKHTKKFKRHH
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tpf:TPHA_0E00690  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MASSLPHPKIVKKHTKKFKRHHSDRYHRVGESWRKQKVLTLLLEEDSEGNISEPKIGYGSNNKTKFLTPSGHKTLLIANVKDLELLTMHTKSYAAEIAHNVSSKNRVTILSRAKALGVKITNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.85
3 0.9
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.9
13 0.83
14 0.72
15 0.65
16 0.63
17 0.62
18 0.61
19 0.61
20 0.55
21 0.52
22 0.52
23 0.53
24 0.5
25 0.45
26 0.37
27 0.32
28 0.29
29 0.28
30 0.28
31 0.24
32 0.18
33 0.12
34 0.1
35 0.06
36 0.05
37 0.06
38 0.06
39 0.07
40 0.06
41 0.06
42 0.07
43 0.06
44 0.08
45 0.15
46 0.22
47 0.3
48 0.31
49 0.32
50 0.32
51 0.33
52 0.33
53 0.29
54 0.27
55 0.21
56 0.28
57 0.32
58 0.33
59 0.32
60 0.3
61 0.29
62 0.31
63 0.31
64 0.24
65 0.19
66 0.19
67 0.19
68 0.18
69 0.16
70 0.09
71 0.06
72 0.08
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.12
81 0.1
82 0.11
83 0.13
84 0.15
85 0.17
86 0.18
87 0.17
88 0.15
89 0.2
90 0.19
91 0.19
92 0.18
93 0.18
94 0.21
95 0.29
96 0.37
97 0.37
98 0.37
99 0.36
100 0.36
101 0.36
102 0.34
103 0.32
104 0.26
105 0.27
106 0.34
107 0.42
108 0.46
109 0.45
110 0.47
111 0.43