Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3G105

Protein Details
Accession A0A2H3G105    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-85HDSGKVYTKKHHKCKCPKGEKWHHIEKKCKKBasic
NLS Segment(s)
Subcellular Location(s) cyto 17, extr 5, mito 3
Family & Domain DBs
Amino Acid Sequences MLLNKAFLGALLAMGTVTALPNPDAEPADLEDRSILHHCGKHASWDHAKSECVCHDSGKVYTKKHHKCKCPKGEKWHHIEKKCKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.03
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.08
11 0.09
12 0.09
13 0.1
14 0.11
15 0.14
16 0.13
17 0.12
18 0.11
19 0.1
20 0.12
21 0.12
22 0.12
23 0.12
24 0.13
25 0.14
26 0.17
27 0.17
28 0.2
29 0.21
30 0.24
31 0.26
32 0.28
33 0.29
34 0.27
35 0.28
36 0.24
37 0.25
38 0.22
39 0.19
40 0.18
41 0.16
42 0.17
43 0.18
44 0.21
45 0.26
46 0.28
47 0.29
48 0.37
49 0.46
50 0.55
51 0.63
52 0.69
53 0.71
54 0.78
55 0.87
56 0.9
57 0.9
58 0.89
59 0.9
60 0.92
61 0.91
62 0.88
63 0.88
64 0.86
65 0.84