Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3HIT1

Protein Details
Accession A0A2H3HIT1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-78RDLEQKKRDLAQRKRHISRKRRASWNPBasic
NLS Segment(s)
PositionSequence
50-75KKRDLEQKKRDLAQRKRHISRKRRAS
Subcellular Location(s) extr 16, mito 4, plas 3, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MRFSIFTLVALVSASSASLVRRVDVNVPAMTNADGVVVPFDTAGVVQPAKKRDLEQKKRDLAQRKRHISRKRRASWNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.05
5 0.09
6 0.09
7 0.1
8 0.11
9 0.12
10 0.15
11 0.17
12 0.19
13 0.16
14 0.16
15 0.16
16 0.16
17 0.14
18 0.11
19 0.09
20 0.06
21 0.05
22 0.05
23 0.05
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.05
33 0.07
34 0.11
35 0.13
36 0.16
37 0.17
38 0.19
39 0.29
40 0.4
41 0.49
42 0.55
43 0.62
44 0.67
45 0.72
46 0.77
47 0.77
48 0.76
49 0.77
50 0.78
51 0.79
52 0.81
53 0.85
54 0.88
55 0.88
56 0.88
57 0.88
58 0.88