Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BVL9

Protein Details
Accession G8BVL9   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
6-25GDNRKKVNTRQEREKCWESRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 13.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003213  Cyt_c_oxidase_su6B  
IPR036549  Cyt_c_oxidase_su6B_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0045277  C:respiratory chain complex IV  
KEGG tpf:TPHA_0G01100  -  
Pfam View protein in Pfam  
PF02297  COX6B  
Amino Acid Sequences MGWLFGDNRKKVNTRQEREKCWESRDLFFGCLDKNNILDVRTEKNSKLAKSACSAELKGFENNCSNSWIKYFKEKRVVDFKKKKIEQEMIENNIQPLNLSPQQYNSMQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.73
4 0.76
5 0.8
6 0.81
7 0.74
8 0.67
9 0.67
10 0.59
11 0.54
12 0.5
13 0.44
14 0.37
15 0.33
16 0.3
17 0.23
18 0.22
19 0.21
20 0.16
21 0.15
22 0.16
23 0.16
24 0.15
25 0.16
26 0.16
27 0.18
28 0.22
29 0.23
30 0.21
31 0.28
32 0.31
33 0.3
34 0.33
35 0.3
36 0.28
37 0.29
38 0.31
39 0.26
40 0.24
41 0.24
42 0.19
43 0.19
44 0.19
45 0.19
46 0.17
47 0.16
48 0.18
49 0.19
50 0.19
51 0.2
52 0.19
53 0.17
54 0.19
55 0.21
56 0.19
57 0.28
58 0.33
59 0.36
60 0.46
61 0.46
62 0.5
63 0.57
64 0.65
65 0.65
66 0.7
67 0.71
68 0.72
69 0.74
70 0.74
71 0.71
72 0.71
73 0.63
74 0.64
75 0.64
76 0.58
77 0.57
78 0.52
79 0.44
80 0.37
81 0.32
82 0.22
83 0.16
84 0.18
85 0.2
86 0.22
87 0.22
88 0.25
89 0.3
90 0.34