Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3GNK1

Protein Details
Accession A0A2H3GNK1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
30-50AQRPECRRLAKPKCRGEKKSQBasic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 11.5, nucl 7.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTLDVKQQDAANVVWAAEAAEVGRTGGRGAQRPECRRLAKPKCRGEKKSQIKTNEMVPGGDVKSSRSSVPLKTLVTKKGQLSESLSSGSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.08
5 0.08
6 0.04
7 0.04
8 0.04
9 0.05
10 0.05
11 0.05
12 0.05
13 0.08
14 0.1
15 0.14
16 0.18
17 0.26
18 0.35
19 0.39
20 0.45
21 0.49
22 0.5
23 0.51
24 0.59
25 0.61
26 0.62
27 0.68
28 0.72
29 0.75
30 0.8
31 0.8
32 0.78
33 0.79
34 0.79
35 0.79
36 0.77
37 0.7
38 0.65
39 0.61
40 0.56
41 0.5
42 0.4
43 0.3
44 0.24
45 0.22
46 0.19
47 0.19
48 0.15
49 0.12
50 0.14
51 0.16
52 0.16
53 0.17
54 0.2
55 0.21
56 0.26
57 0.29
58 0.28
59 0.34
60 0.39
61 0.4
62 0.43
63 0.46
64 0.43
65 0.45
66 0.44
67 0.4
68 0.41
69 0.4
70 0.36