Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BRU9

Protein Details
Accession G8BRU9   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
183-249LNERANILRKRRPGKKQRVAKKLAKEKIKEREQLLKTLKKEKKKMFNKRGGKKNKKKETLNPLKDAABasic
NLS Segment(s)
PositionSequence
190-239LRKRRPGKKQRVAKKLAKEKIKEREQLLKTLKKEKKKMFNKRGGKKNKKK
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
KEGG tpf:TPHA_0C03220  -  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MNHLKIVSRKDLYDEPFSTIDDESLEGNNRVILAEPIFEIVEVDNINNKEDSNKGDSNNENDDEENNQVHDEFDFPLFSFGASFPISNVDQVETNSEDIAGRGGSEVKLMKISLREPSPEITNTERPDSYYFATYTEDDKRNFEKSAIEFDAIFEDKAININRPGKKHKIIVLEDYNKKINELNERANILRKRRPGKKQRVAKKLAKEKIKEREQLLKTLKKEKKKMFNKRGGKKNKKKETLNPLKDAAATIIQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.38
4 0.38
5 0.34
6 0.28
7 0.23
8 0.16
9 0.15
10 0.12
11 0.13
12 0.15
13 0.14
14 0.14
15 0.14
16 0.13
17 0.12
18 0.12
19 0.11
20 0.09
21 0.09
22 0.09
23 0.1
24 0.1
25 0.09
26 0.09
27 0.07
28 0.09
29 0.08
30 0.08
31 0.13
32 0.13
33 0.15
34 0.15
35 0.15
36 0.15
37 0.16
38 0.2
39 0.22
40 0.24
41 0.25
42 0.3
43 0.33
44 0.36
45 0.39
46 0.36
47 0.3
48 0.27
49 0.27
50 0.23
51 0.23
52 0.18
53 0.14
54 0.13
55 0.12
56 0.11
57 0.11
58 0.1
59 0.09
60 0.09
61 0.09
62 0.09
63 0.1
64 0.09
65 0.09
66 0.08
67 0.07
68 0.09
69 0.09
70 0.09
71 0.08
72 0.11
73 0.11
74 0.11
75 0.12
76 0.1
77 0.1
78 0.1
79 0.13
80 0.1
81 0.11
82 0.1
83 0.1
84 0.09
85 0.08
86 0.08
87 0.05
88 0.04
89 0.04
90 0.05
91 0.05
92 0.07
93 0.07
94 0.07
95 0.08
96 0.08
97 0.09
98 0.1
99 0.11
100 0.14
101 0.14
102 0.15
103 0.16
104 0.17
105 0.18
106 0.18
107 0.19
108 0.19
109 0.23
110 0.23
111 0.24
112 0.23
113 0.22
114 0.23
115 0.22
116 0.19
117 0.16
118 0.14
119 0.13
120 0.15
121 0.14
122 0.15
123 0.19
124 0.22
125 0.21
126 0.24
127 0.25
128 0.26
129 0.26
130 0.24
131 0.22
132 0.2
133 0.25
134 0.24
135 0.22
136 0.19
137 0.19
138 0.21
139 0.17
140 0.15
141 0.09
142 0.08
143 0.07
144 0.11
145 0.12
146 0.11
147 0.15
148 0.23
149 0.26
150 0.31
151 0.37
152 0.41
153 0.45
154 0.48
155 0.48
156 0.49
157 0.48
158 0.51
159 0.53
160 0.55
161 0.53
162 0.52
163 0.5
164 0.42
165 0.4
166 0.35
167 0.3
168 0.31
169 0.33
170 0.35
171 0.35
172 0.38
173 0.38
174 0.44
175 0.45
176 0.43
177 0.44
178 0.48
179 0.54
180 0.61
181 0.71
182 0.74
183 0.8
184 0.83
185 0.87
186 0.88
187 0.89
188 0.89
189 0.86
190 0.85
191 0.84
192 0.82
193 0.81
194 0.77
195 0.76
196 0.77
197 0.78
198 0.73
199 0.67
200 0.7
201 0.63
202 0.66
203 0.65
204 0.63
205 0.59
206 0.64
207 0.66
208 0.66
209 0.74
210 0.74
211 0.76
212 0.8
213 0.86
214 0.87
215 0.9
216 0.91
217 0.91
218 0.92
219 0.93
220 0.93
221 0.93
222 0.93
223 0.93
224 0.92
225 0.91
226 0.9
227 0.9
228 0.9
229 0.88
230 0.82
231 0.74
232 0.66
233 0.57
234 0.48
235 0.4