Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BWS1

Protein Details
Accession G8BWS1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
105-134DIKKGEVHIKKSKNKKKNKIRCSYCNETGHHydrophilic
NLS Segment(s)
PositionSequence
110-123EVHIKKSKNKKKNK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG tpf:TPHA_0H00140  -  
Pfam View protein in Pfam  
PF16588  zf-C2H2_10  
Amino Acid Sequences MANTLKNDDIVKFSYAMDQIAKLIAQNKKQSSVANSEYEKKMKELDKLINLLLGLSKSTSSKGYSLNTSKLDEILKEGFEVVTKGNDEKYIMLPIQEEPQGPLEDIKKGEVHIKKSKNKKKNKIRCSYCNETGHTRAKCEMKLMTPIREHYNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.17
5 0.15
6 0.14
7 0.14
8 0.13
9 0.11
10 0.17
11 0.21
12 0.27
13 0.34
14 0.36
15 0.39
16 0.41
17 0.42
18 0.4
19 0.42
20 0.39
21 0.37
22 0.37
23 0.39
24 0.41
25 0.41
26 0.37
27 0.31
28 0.33
29 0.3
30 0.33
31 0.33
32 0.36
33 0.37
34 0.38
35 0.36
36 0.31
37 0.28
38 0.23
39 0.17
40 0.11
41 0.07
42 0.06
43 0.07
44 0.06
45 0.08
46 0.09
47 0.09
48 0.11
49 0.14
50 0.15
51 0.2
52 0.23
53 0.25
54 0.26
55 0.26
56 0.24
57 0.23
58 0.21
59 0.16
60 0.15
61 0.12
62 0.11
63 0.09
64 0.09
65 0.08
66 0.07
67 0.08
68 0.05
69 0.06
70 0.06
71 0.07
72 0.07
73 0.08
74 0.08
75 0.09
76 0.09
77 0.11
78 0.1
79 0.1
80 0.1
81 0.11
82 0.13
83 0.13
84 0.12
85 0.11
86 0.13
87 0.13
88 0.13
89 0.14
90 0.13
91 0.15
92 0.15
93 0.15
94 0.14
95 0.14
96 0.22
97 0.24
98 0.3
99 0.37
100 0.45
101 0.53
102 0.63
103 0.73
104 0.75
105 0.82
106 0.85
107 0.88
108 0.9
109 0.92
110 0.92
111 0.91
112 0.91
113 0.89
114 0.87
115 0.84
116 0.79
117 0.72
118 0.68
119 0.65
120 0.64
121 0.57
122 0.51
123 0.48
124 0.47
125 0.44
126 0.42
127 0.39
128 0.34
129 0.42
130 0.44
131 0.44
132 0.44
133 0.46