Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3G0M3

Protein Details
Accession A0A2H3G0M3   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-84VPSSPQLRSKRRRVETRRRRRRAPALTHydrophilic
NLS Segment(s)
PositionSequence
65-80RSKRRRVETRRRRRRA
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MQRKDVEDFFDLMSHDTSCTESCSSTPPGSESDVDYTDHNGDLVGFVEPDSPVRELSVPSSPQLRSKRRRVETRRRRRRAPALTIALSSSDVETTMTMSDETKGASGHALQLPLSEPLSKQLDYVQRVLGDMINLLQTTKVCAERAAVGDPEGLEAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.12
4 0.13
5 0.12
6 0.15
7 0.14
8 0.13
9 0.14
10 0.18
11 0.21
12 0.21
13 0.21
14 0.19
15 0.2
16 0.23
17 0.23
18 0.2
19 0.19
20 0.19
21 0.2
22 0.18
23 0.19
24 0.17
25 0.16
26 0.13
27 0.1
28 0.08
29 0.08
30 0.08
31 0.06
32 0.05
33 0.05
34 0.06
35 0.06
36 0.07
37 0.09
38 0.08
39 0.08
40 0.09
41 0.1
42 0.1
43 0.12
44 0.16
45 0.15
46 0.15
47 0.19
48 0.18
49 0.25
50 0.34
51 0.41
52 0.45
53 0.53
54 0.63
55 0.67
56 0.77
57 0.8
58 0.82
59 0.84
60 0.88
61 0.89
62 0.86
63 0.85
64 0.82
65 0.83
66 0.8
67 0.76
68 0.72
69 0.66
70 0.6
71 0.54
72 0.45
73 0.35
74 0.27
75 0.19
76 0.11
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.09
95 0.11
96 0.11
97 0.1
98 0.11
99 0.12
100 0.12
101 0.13
102 0.1
103 0.09
104 0.13
105 0.17
106 0.17
107 0.16
108 0.2
109 0.27
110 0.29
111 0.31
112 0.28
113 0.25
114 0.25
115 0.26
116 0.21
117 0.14
118 0.11
119 0.1
120 0.09
121 0.08
122 0.08
123 0.09
124 0.08
125 0.11
126 0.14
127 0.16
128 0.15
129 0.16
130 0.18
131 0.2
132 0.23
133 0.23
134 0.21
135 0.19
136 0.2
137 0.19