Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3GFT4

Protein Details
Accession A0A2H3GFT4   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-27SDTNRFPRPTTSRKRRHAASNASKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MASDTNRFPRPTTSRKRRHAASNASKAISALIADPSNDEAPDPTPATPPSKRRMAQDESPYTNNSSFAESSADESSPALTESSPTDSESSDESSAVATGRSPPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.84
4 0.81
5 0.82
6 0.81
7 0.81
8 0.8
9 0.8
10 0.74
11 0.67
12 0.6
13 0.5
14 0.41
15 0.3
16 0.19
17 0.1
18 0.09
19 0.08
20 0.08
21 0.09
22 0.11
23 0.11
24 0.1
25 0.09
26 0.08
27 0.09
28 0.11
29 0.12
30 0.1
31 0.11
32 0.13
33 0.18
34 0.22
35 0.25
36 0.28
37 0.34
38 0.35
39 0.37
40 0.42
41 0.43
42 0.45
43 0.49
44 0.5
45 0.46
46 0.46
47 0.44
48 0.39
49 0.34
50 0.28
51 0.2
52 0.17
53 0.14
54 0.13
55 0.13
56 0.12
57 0.14
58 0.14
59 0.14
60 0.11
61 0.11
62 0.11
63 0.09
64 0.1
65 0.07
66 0.06
67 0.07
68 0.09
69 0.13
70 0.13
71 0.14
72 0.15
73 0.15
74 0.16
75 0.17
76 0.19
77 0.16
78 0.15
79 0.14
80 0.13
81 0.13
82 0.12
83 0.1
84 0.07