Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3G208

Protein Details
Accession A0A2H3G208    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-31TEKEARKQRGRTSVQHQRANRRTNNAQTRSHydrophilic
NLS Segment(s)
PositionSequence
109-109R
124-124K
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MTEKEARKQRGRTSVQHQRANRRTNNAQTRSANLEHNRHSGCAKSSDANLVRDVIVVAQSPSPSPRPRQNNKRDLTAPPSLDLSNSHSEPLSVEQTESQPRGASWFKKRKNASELTARSAPAPKRQKASSLPPHTPRGTLEASHKGTRMKDLTDDERTYILRLNNKTTAIRNNADRVLAQQIENENRLKALNSSQRLLQQELNTAQADLTRIRQDIQDNNVIRDSILRIIQRRAADNADGWNIALEHCDKSLKVFGDDSKKTMAIINHKKKEIEHVDEMVASAKLAAEQCAEQAEALAVHLDQLTRMKSAFDVLKVMVDMGPLGLASLGGEKLTELERLVTPDVGGDGKDVEMREG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.81
4 0.79
5 0.8
6 0.82
7 0.83
8 0.8
9 0.77
10 0.76
11 0.78
12 0.82
13 0.76
14 0.75
15 0.68
16 0.66
17 0.64
18 0.58
19 0.56
20 0.52
21 0.54
22 0.5
23 0.55
24 0.51
25 0.46
26 0.45
27 0.41
28 0.38
29 0.34
30 0.32
31 0.28
32 0.28
33 0.36
34 0.38
35 0.36
36 0.34
37 0.31
38 0.28
39 0.25
40 0.23
41 0.14
42 0.11
43 0.1
44 0.1
45 0.1
46 0.1
47 0.11
48 0.14
49 0.2
50 0.24
51 0.29
52 0.38
53 0.47
54 0.58
55 0.68
56 0.75
57 0.79
58 0.78
59 0.8
60 0.74
61 0.69
62 0.65
63 0.61
64 0.51
65 0.42
66 0.41
67 0.33
68 0.29
69 0.25
70 0.24
71 0.22
72 0.21
73 0.21
74 0.18
75 0.18
76 0.19
77 0.21
78 0.19
79 0.14
80 0.14
81 0.15
82 0.18
83 0.23
84 0.23
85 0.2
86 0.17
87 0.17
88 0.21
89 0.25
90 0.29
91 0.34
92 0.44
93 0.5
94 0.58
95 0.63
96 0.65
97 0.69
98 0.67
99 0.62
100 0.62
101 0.59
102 0.56
103 0.54
104 0.47
105 0.4
106 0.4
107 0.37
108 0.36
109 0.43
110 0.4
111 0.43
112 0.44
113 0.48
114 0.48
115 0.55
116 0.56
117 0.55
118 0.57
119 0.57
120 0.62
121 0.57
122 0.52
123 0.43
124 0.37
125 0.31
126 0.26
127 0.26
128 0.29
129 0.31
130 0.32
131 0.32
132 0.3
133 0.29
134 0.32
135 0.29
136 0.21
137 0.22
138 0.24
139 0.28
140 0.3
141 0.3
142 0.26
143 0.26
144 0.25
145 0.22
146 0.22
147 0.2
148 0.2
149 0.22
150 0.25
151 0.26
152 0.27
153 0.28
154 0.27
155 0.3
156 0.29
157 0.29
158 0.27
159 0.28
160 0.27
161 0.25
162 0.23
163 0.19
164 0.17
165 0.16
166 0.14
167 0.13
168 0.15
169 0.16
170 0.18
171 0.17
172 0.14
173 0.13
174 0.14
175 0.12
176 0.11
177 0.15
178 0.2
179 0.22
180 0.23
181 0.24
182 0.28
183 0.3
184 0.31
185 0.28
186 0.22
187 0.24
188 0.23
189 0.24
190 0.2
191 0.18
192 0.15
193 0.13
194 0.13
195 0.1
196 0.11
197 0.11
198 0.11
199 0.12
200 0.15
201 0.17
202 0.2
203 0.23
204 0.29
205 0.28
206 0.29
207 0.28
208 0.26
209 0.23
210 0.2
211 0.17
212 0.12
213 0.14
214 0.15
215 0.17
216 0.19
217 0.24
218 0.24
219 0.25
220 0.25
221 0.24
222 0.22
223 0.21
224 0.21
225 0.18
226 0.17
227 0.14
228 0.12
229 0.1
230 0.09
231 0.09
232 0.09
233 0.08
234 0.09
235 0.1
236 0.1
237 0.12
238 0.17
239 0.17
240 0.17
241 0.18
242 0.23
243 0.31
244 0.32
245 0.32
246 0.29
247 0.28
248 0.27
249 0.28
250 0.27
251 0.29
252 0.39
253 0.48
254 0.51
255 0.54
256 0.55
257 0.52
258 0.58
259 0.55
260 0.51
261 0.44
262 0.4
263 0.39
264 0.37
265 0.37
266 0.28
267 0.2
268 0.13
269 0.09
270 0.06
271 0.08
272 0.08
273 0.09
274 0.08
275 0.09
276 0.1
277 0.11
278 0.11
279 0.09
280 0.08
281 0.08
282 0.07
283 0.07
284 0.07
285 0.05
286 0.06
287 0.06
288 0.06
289 0.07
290 0.1
291 0.12
292 0.12
293 0.13
294 0.13
295 0.13
296 0.18
297 0.2
298 0.18
299 0.19
300 0.19
301 0.2
302 0.19
303 0.2
304 0.15
305 0.12
306 0.1
307 0.07
308 0.07
309 0.05
310 0.05
311 0.04
312 0.04
313 0.04
314 0.05
315 0.06
316 0.05
317 0.06
318 0.06
319 0.08
320 0.09
321 0.1
322 0.09
323 0.12
324 0.13
325 0.17
326 0.19
327 0.18
328 0.16
329 0.16
330 0.17
331 0.15
332 0.13
333 0.11
334 0.1
335 0.1
336 0.13