Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3HV79

Protein Details
Accession A0A2H3HV79    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
134-161SNGQGNDHGKRQKRRKQKRSDHTEAQVVHydrophilic
NLS Segment(s)
PositionSequence
142-152GKRQKRRKQKR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
Amino Acid Sequences MTKRKSTTGAEESYQDNHHGNRGGRAGRGGRGGRCNGRGGHHDGGHWQGGPFPGQAPVHAVTHSTTIHYGPPAPPGYAAGFQHGQFPSHQPVSAGPALPPYQFAPQVPWQSGNGISNPFSQPQQVPQIQDASPSNGQGNDHGKRQKRRKQKRSDHTEAQVVAGVETGQGPSSGSRTLRVRSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.3
3 0.26
4 0.23
5 0.25
6 0.29
7 0.28
8 0.29
9 0.34
10 0.33
11 0.32
12 0.36
13 0.35
14 0.32
15 0.38
16 0.36
17 0.35
18 0.39
19 0.43
20 0.43
21 0.43
22 0.44
23 0.39
24 0.39
25 0.39
26 0.4
27 0.39
28 0.35
29 0.32
30 0.31
31 0.32
32 0.29
33 0.25
34 0.18
35 0.14
36 0.14
37 0.15
38 0.13
39 0.1
40 0.14
41 0.13
42 0.13
43 0.15
44 0.16
45 0.16
46 0.15
47 0.15
48 0.12
49 0.14
50 0.14
51 0.11
52 0.1
53 0.1
54 0.11
55 0.11
56 0.12
57 0.1
58 0.15
59 0.15
60 0.14
61 0.14
62 0.14
63 0.15
64 0.16
65 0.16
66 0.14
67 0.14
68 0.14
69 0.19
70 0.18
71 0.16
72 0.15
73 0.17
74 0.19
75 0.18
76 0.18
77 0.13
78 0.13
79 0.17
80 0.17
81 0.15
82 0.11
83 0.13
84 0.13
85 0.13
86 0.14
87 0.11
88 0.12
89 0.12
90 0.12
91 0.14
92 0.19
93 0.22
94 0.21
95 0.21
96 0.2
97 0.2
98 0.22
99 0.18
100 0.15
101 0.13
102 0.14
103 0.15
104 0.16
105 0.16
106 0.15
107 0.16
108 0.15
109 0.17
110 0.24
111 0.24
112 0.25
113 0.25
114 0.28
115 0.26
116 0.29
117 0.26
118 0.24
119 0.22
120 0.21
121 0.2
122 0.18
123 0.19
124 0.2
125 0.26
126 0.23
127 0.29
128 0.36
129 0.43
130 0.53
131 0.63
132 0.68
133 0.72
134 0.81
135 0.85
136 0.89
137 0.92
138 0.93
139 0.92
140 0.92
141 0.9
142 0.84
143 0.79
144 0.68
145 0.58
146 0.5
147 0.39
148 0.3
149 0.21
150 0.15
151 0.09
152 0.09
153 0.08
154 0.06
155 0.06
156 0.06
157 0.07
158 0.1
159 0.14
160 0.14
161 0.2
162 0.24
163 0.31