Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3GQN0

Protein Details
Accession A0A2H3GQN0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-73CGSKGGRAKRRGHSHMRTTRVBasic
NLS Segment(s)
PositionSequence
59-63RAKRR
Subcellular Location(s) plas 11, vacu 5, mito 4, extr 4, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGGVMSCIRSCLQTIGDVIMAIIGGIGRIITAIVNGIVAFCSILVRFLTCGYCGSKGGRAKRRGHSHMRTTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.13
5 0.11
6 0.09
7 0.08
8 0.05
9 0.04
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.02
28 0.03
29 0.03
30 0.04
31 0.05
32 0.05
33 0.06
34 0.07
35 0.08
36 0.08
37 0.1
38 0.11
39 0.13
40 0.14
41 0.15
42 0.21
43 0.27
44 0.36
45 0.44
46 0.5
47 0.57
48 0.66
49 0.74
50 0.76
51 0.8
52 0.79
53 0.81