Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BS17

Protein Details
Accession G8BS17   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
77-112ELDSVMRKRKKKMKKHKLRKRRKREKAEKRKLSQGRBasic
NLS Segment(s)
PositionSequence
83-112RKRKKKMKKHKLRKRRKREKAEKRKLSQGR
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG tpf:TPHA_0D04575  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFGIVRNCAWKAPRALHGVFNLKLRKNYLHTFVDSRASSILGNPVINSKVLVQLNLRPLAPLAPVRDVPHQNIVEMELDSVMRKRKKKMKKHKLRKRRKREKAEKRKLSQGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.43
4 0.46
5 0.46
6 0.42
7 0.44
8 0.44
9 0.41
10 0.42
11 0.41
12 0.4
13 0.4
14 0.42
15 0.42
16 0.39
17 0.39
18 0.39
19 0.37
20 0.39
21 0.33
22 0.29
23 0.23
24 0.2
25 0.17
26 0.14
27 0.16
28 0.11
29 0.11
30 0.1
31 0.11
32 0.11
33 0.11
34 0.11
35 0.08
36 0.13
37 0.13
38 0.13
39 0.13
40 0.16
41 0.19
42 0.19
43 0.19
44 0.13
45 0.13
46 0.13
47 0.13
48 0.12
49 0.1
50 0.11
51 0.13
52 0.15
53 0.21
54 0.22
55 0.23
56 0.28
57 0.26
58 0.24
59 0.23
60 0.22
61 0.18
62 0.16
63 0.14
64 0.07
65 0.07
66 0.08
67 0.1
68 0.16
69 0.22
70 0.26
71 0.35
72 0.45
73 0.56
74 0.66
75 0.75
76 0.8
77 0.85
78 0.92
79 0.94
80 0.96
81 0.97
82 0.97
83 0.97
84 0.97
85 0.96
86 0.97
87 0.97
88 0.97
89 0.97
90 0.97
91 0.96
92 0.92