Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3HMU3

Protein Details
Accession A0A2H3HMU3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
271-295APVTPPKTGCSSKRRRARRAARRSLHydrophilic
NLS Segment(s)
PositionSequence
283-295KRRRARRAARRSL
Subcellular Location(s) extr 15, cyto 7.5, cyto_nucl 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005103  AA9  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF03443  AA9  
CDD cd21175  LPMO_AA9  
Amino Acid Sequences MRFSASAAALAMATTVSAHAQVYGLWVNGKDQGDGRNVYIRSPASNSPVKDLTSPDLVCNVNGAKAAPKFVKAASGDELTFEWYHDNRGDDIIDGSHKGPIITYIAPYTETDGTGAIWTKIAEDGYDGSEWAVDKLIKAKGKSTFTLPSALKAGKYIVRQEIIAHHESDVAYASNPARGAQFYPSCAQVEVTGSGTAVPDEKFDFNKGYTSTDKGIVFNLYGSYTTYDIPGPAPAGGNAGSETQAPAPTPTFATVVRPSEGASAPTEAPSAPVTPPKTGCSSKRRRARRAARRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.05
5 0.06
6 0.06
7 0.06
8 0.06
9 0.1
10 0.11
11 0.11
12 0.11
13 0.12
14 0.13
15 0.18
16 0.19
17 0.17
18 0.18
19 0.21
20 0.25
21 0.26
22 0.27
23 0.29
24 0.28
25 0.28
26 0.31
27 0.28
28 0.25
29 0.28
30 0.29
31 0.28
32 0.34
33 0.34
34 0.34
35 0.36
36 0.34
37 0.32
38 0.32
39 0.29
40 0.3
41 0.29
42 0.24
43 0.26
44 0.25
45 0.23
46 0.23
47 0.2
48 0.14
49 0.14
50 0.14
51 0.15
52 0.15
53 0.2
54 0.18
55 0.2
56 0.2
57 0.2
58 0.25
59 0.21
60 0.23
61 0.22
62 0.23
63 0.21
64 0.2
65 0.2
66 0.17
67 0.16
68 0.14
69 0.13
70 0.12
71 0.14
72 0.15
73 0.16
74 0.14
75 0.15
76 0.15
77 0.13
78 0.13
79 0.11
80 0.1
81 0.1
82 0.1
83 0.1
84 0.1
85 0.09
86 0.09
87 0.09
88 0.11
89 0.1
90 0.1
91 0.1
92 0.1
93 0.11
94 0.11
95 0.13
96 0.11
97 0.1
98 0.1
99 0.09
100 0.09
101 0.09
102 0.09
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.07
113 0.07
114 0.07
115 0.06
116 0.07
117 0.07
118 0.06
119 0.07
120 0.05
121 0.05
122 0.09
123 0.14
124 0.16
125 0.16
126 0.2
127 0.24
128 0.27
129 0.28
130 0.28
131 0.27
132 0.25
133 0.31
134 0.27
135 0.23
136 0.23
137 0.22
138 0.18
139 0.15
140 0.16
141 0.14
142 0.15
143 0.17
144 0.16
145 0.17
146 0.17
147 0.17
148 0.19
149 0.2
150 0.2
151 0.17
152 0.15
153 0.16
154 0.15
155 0.15
156 0.12
157 0.08
158 0.06
159 0.08
160 0.08
161 0.08
162 0.08
163 0.08
164 0.08
165 0.09
166 0.1
167 0.13
168 0.14
169 0.15
170 0.16
171 0.17
172 0.17
173 0.17
174 0.16
175 0.12
176 0.12
177 0.11
178 0.11
179 0.1
180 0.09
181 0.09
182 0.09
183 0.08
184 0.08
185 0.07
186 0.06
187 0.09
188 0.1
189 0.11
190 0.13
191 0.15
192 0.14
193 0.18
194 0.18
195 0.2
196 0.2
197 0.23
198 0.23
199 0.25
200 0.25
201 0.23
202 0.23
203 0.2
204 0.18
205 0.15
206 0.13
207 0.1
208 0.09
209 0.1
210 0.1
211 0.1
212 0.1
213 0.11
214 0.1
215 0.1
216 0.11
217 0.11
218 0.1
219 0.09
220 0.1
221 0.09
222 0.1
223 0.1
224 0.1
225 0.1
226 0.09
227 0.09
228 0.09
229 0.1
230 0.1
231 0.1
232 0.1
233 0.11
234 0.12
235 0.13
236 0.14
237 0.14
238 0.15
239 0.15
240 0.2
241 0.23
242 0.25
243 0.24
244 0.23
245 0.22
246 0.24
247 0.25
248 0.21
249 0.18
250 0.18
251 0.18
252 0.18
253 0.18
254 0.14
255 0.15
256 0.14
257 0.14
258 0.14
259 0.2
260 0.23
261 0.27
262 0.3
263 0.32
264 0.37
265 0.42
266 0.49
267 0.53
268 0.61
269 0.66
270 0.73
271 0.8
272 0.83
273 0.88
274 0.9
275 0.91