Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3HYE5

Protein Details
Accession A0A2H3HYE5   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-118AAPPLKLRLRPRPQRREPVGPKKVTKRAAPRALNKRRRABasic
NLS Segment(s)
PositionSequence
83-118PLKLRLRPRPQRREPVGPKKVTKRAAPRALNKRRRA
Subcellular Location(s) nucl 14, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MLLPSALPCDASHSTHSRLQPSLFSPPASPPAFSSHASFANIMTTCRSLQSLLSTPAPIITNPRPTPSLAQLPTPPLAHAAPPLKLRLRPRPQRREPVGPKKVTKRAAPRALNKRRRAADEEAERDSSASESGSESPSRRPIKQVAPSTPKRTRIAPEQLPLGLDRSDFHNMHLRQGGHLLGEEDSSDEEDWSAEDDRILIEIVLEKLRLSKAEWQDCARNLGRDRHAVDRRWKTLLLNGDIGLKSRPGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.42
4 0.39
5 0.4
6 0.39
7 0.38
8 0.37
9 0.41
10 0.37
11 0.34
12 0.31
13 0.32
14 0.38
15 0.34
16 0.31
17 0.25
18 0.29
19 0.31
20 0.31
21 0.31
22 0.26
23 0.27
24 0.28
25 0.27
26 0.21
27 0.22
28 0.22
29 0.19
30 0.18
31 0.17
32 0.16
33 0.17
34 0.17
35 0.13
36 0.13
37 0.18
38 0.2
39 0.21
40 0.22
41 0.22
42 0.21
43 0.22
44 0.22
45 0.17
46 0.19
47 0.21
48 0.29
49 0.29
50 0.32
51 0.31
52 0.32
53 0.36
54 0.34
55 0.38
56 0.3
57 0.32
58 0.31
59 0.32
60 0.33
61 0.29
62 0.24
63 0.18
64 0.17
65 0.15
66 0.18
67 0.17
68 0.18
69 0.19
70 0.23
71 0.23
72 0.28
73 0.33
74 0.39
75 0.47
76 0.55
77 0.64
78 0.72
79 0.77
80 0.84
81 0.84
82 0.84
83 0.84
84 0.84
85 0.82
86 0.77
87 0.74
88 0.72
89 0.73
90 0.67
91 0.63
92 0.62
93 0.63
94 0.67
95 0.67
96 0.68
97 0.72
98 0.78
99 0.81
100 0.76
101 0.74
102 0.68
103 0.65
104 0.62
105 0.56
106 0.53
107 0.51
108 0.48
109 0.43
110 0.4
111 0.36
112 0.3
113 0.25
114 0.17
115 0.1
116 0.07
117 0.05
118 0.05
119 0.07
120 0.08
121 0.09
122 0.1
123 0.12
124 0.21
125 0.24
126 0.23
127 0.26
128 0.3
129 0.37
130 0.44
131 0.48
132 0.48
133 0.54
134 0.58
135 0.63
136 0.63
137 0.61
138 0.55
139 0.52
140 0.48
141 0.48
142 0.51
143 0.47
144 0.44
145 0.4
146 0.38
147 0.36
148 0.32
149 0.25
150 0.16
151 0.12
152 0.1
153 0.12
154 0.17
155 0.17
156 0.19
157 0.26
158 0.26
159 0.29
160 0.33
161 0.3
162 0.25
163 0.26
164 0.25
165 0.16
166 0.16
167 0.13
168 0.09
169 0.09
170 0.08
171 0.07
172 0.07
173 0.08
174 0.08
175 0.07
176 0.07
177 0.07
178 0.07
179 0.09
180 0.1
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.09
187 0.06
188 0.05
189 0.07
190 0.09
191 0.1
192 0.1
193 0.09
194 0.11
195 0.13
196 0.13
197 0.14
198 0.21
199 0.3
200 0.37
201 0.41
202 0.43
203 0.48
204 0.49
205 0.54
206 0.48
207 0.45
208 0.43
209 0.47
210 0.48
211 0.48
212 0.5
213 0.54
214 0.58
215 0.59
216 0.64
217 0.65
218 0.65
219 0.62
220 0.6
221 0.52
222 0.51
223 0.52
224 0.46
225 0.39
226 0.35
227 0.37
228 0.35
229 0.35
230 0.3