Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JE46

Protein Details
Accession A0A2H3JE46    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
16-43LPRAPIPTPTPPRRRHRHWPTPIASRPHHydrophilic
NLS Segment(s)
PositionSequence
17-35PRAPIPTPTPPRRRHRHWP
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MALTATSPARSSPPRLPRAPIPTPTPPRRRHRHWPTPIASRPHSHTHAHEKATPESRRVPQPRASRAAAVDRGAHTSASSSASVCDTWRPPQADRKHVLSLSGRRSHAAVIGPRCADTQRGRASAGARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.56
4 0.58
5 0.63
6 0.64
7 0.59
8 0.56
9 0.58
10 0.65
11 0.69
12 0.71
13 0.71
14 0.75
15 0.8
16 0.81
17 0.83
18 0.84
19 0.85
20 0.85
21 0.86
22 0.82
23 0.82
24 0.81
25 0.76
26 0.68
27 0.6
28 0.55
29 0.51
30 0.48
31 0.41
32 0.39
33 0.43
34 0.45
35 0.44
36 0.43
37 0.4
38 0.41
39 0.47
40 0.43
41 0.36
42 0.36
43 0.37
44 0.43
45 0.44
46 0.44
47 0.44
48 0.5
49 0.52
50 0.52
51 0.5
52 0.42
53 0.39
54 0.38
55 0.32
56 0.25
57 0.21
58 0.17
59 0.18
60 0.17
61 0.15
62 0.11
63 0.1
64 0.1
65 0.1
66 0.1
67 0.08
68 0.08
69 0.09
70 0.09
71 0.09
72 0.12
73 0.12
74 0.16
75 0.22
76 0.24
77 0.26
78 0.35
79 0.42
80 0.47
81 0.49
82 0.51
83 0.5
84 0.47
85 0.49
86 0.46
87 0.47
88 0.47
89 0.49
90 0.44
91 0.4
92 0.4
93 0.37
94 0.33
95 0.31
96 0.3
97 0.27
98 0.31
99 0.31
100 0.31
101 0.31
102 0.29
103 0.3
104 0.28
105 0.33
106 0.36
107 0.37
108 0.38
109 0.4