Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JNW9

Protein Details
Accession A0A2H3JNW9    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
241-260TSINPKRRWPWMGKRGKILDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11, cyto 7, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR047201  ERI-1_3'hExo-like  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0000175  F:3'-5'-RNA exonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF00929  RNase_T  
CDD cd06133  ERI-1_3'hExo_like  
Amino Acid Sequences MRQGTKQPYEAFLVLDVEGTCVEGNTSFSYPNEIIEWPVCLLRWADKDKDGKAKVLQVVAEFRSFVKPTWRPLLSQFCTNLTGITQDQVDRAPVFTELCESFKVFLEDNGLIDPGTGQRLVKYCWCSDGPYDVRDFVVKQCFISKVPMPAWITGDVLDVRSEVRALLDAETSRKPQERKRSASAYAFPVNPRMVLTIPRQLQALGLSPFEGRHHSGIDDTRNIARILIELARRGVRLMPNTSINPKRRWPWMGKRGKILDGYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.16
4 0.11
5 0.1
6 0.1
7 0.09
8 0.07
9 0.08
10 0.07
11 0.09
12 0.11
13 0.12
14 0.13
15 0.13
16 0.19
17 0.19
18 0.19
19 0.19
20 0.17
21 0.18
22 0.17
23 0.19
24 0.14
25 0.14
26 0.13
27 0.12
28 0.13
29 0.16
30 0.22
31 0.25
32 0.28
33 0.33
34 0.39
35 0.42
36 0.51
37 0.47
38 0.45
39 0.43
40 0.46
41 0.43
42 0.4
43 0.36
44 0.28
45 0.3
46 0.27
47 0.25
48 0.19
49 0.17
50 0.2
51 0.19
52 0.18
53 0.24
54 0.26
55 0.31
56 0.38
57 0.38
58 0.35
59 0.41
60 0.51
61 0.44
62 0.45
63 0.41
64 0.35
65 0.36
66 0.34
67 0.27
68 0.17
69 0.17
70 0.13
71 0.12
72 0.11
73 0.09
74 0.1
75 0.1
76 0.11
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.08
83 0.1
84 0.1
85 0.11
86 0.12
87 0.11
88 0.12
89 0.12
90 0.14
91 0.11
92 0.11
93 0.13
94 0.12
95 0.12
96 0.11
97 0.1
98 0.09
99 0.08
100 0.08
101 0.05
102 0.06
103 0.06
104 0.05
105 0.07
106 0.09
107 0.1
108 0.14
109 0.17
110 0.16
111 0.19
112 0.2
113 0.19
114 0.18
115 0.24
116 0.22
117 0.2
118 0.21
119 0.18
120 0.17
121 0.17
122 0.16
123 0.12
124 0.15
125 0.14
126 0.14
127 0.16
128 0.17
129 0.17
130 0.2
131 0.19
132 0.18
133 0.18
134 0.23
135 0.22
136 0.22
137 0.23
138 0.2
139 0.19
140 0.15
141 0.16
142 0.1
143 0.09
144 0.09
145 0.07
146 0.06
147 0.06
148 0.06
149 0.05
150 0.05
151 0.06
152 0.06
153 0.07
154 0.08
155 0.08
156 0.11
157 0.13
158 0.15
159 0.17
160 0.21
161 0.25
162 0.31
163 0.42
164 0.48
165 0.54
166 0.59
167 0.62
168 0.62
169 0.63
170 0.59
171 0.54
172 0.48
173 0.43
174 0.36
175 0.34
176 0.3
177 0.25
178 0.21
179 0.17
180 0.14
181 0.17
182 0.2
183 0.24
184 0.25
185 0.26
186 0.25
187 0.24
188 0.23
189 0.21
190 0.21
191 0.15
192 0.13
193 0.13
194 0.13
195 0.14
196 0.15
197 0.17
198 0.15
199 0.15
200 0.16
201 0.16
202 0.19
203 0.23
204 0.26
205 0.25
206 0.25
207 0.25
208 0.26
209 0.26
210 0.23
211 0.19
212 0.15
213 0.15
214 0.17
215 0.17
216 0.17
217 0.2
218 0.21
219 0.21
220 0.22
221 0.23
222 0.25
223 0.29
224 0.31
225 0.33
226 0.36
227 0.4
228 0.48
229 0.53
230 0.53
231 0.54
232 0.57
233 0.58
234 0.62
235 0.66
236 0.67
237 0.69
238 0.74
239 0.78
240 0.77
241 0.81
242 0.77
243 0.74